BLASTX nr result
ID: Achyranthes22_contig00042669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00042669 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05583.1| hypothetical protein PRUPE_ppa006757mg [Prunus pe... 68 1e-09 ref|XP_004305334.1| PREDICTED: uncharacterized protein At5g39865... 68 1e-09 ref|XP_002309426.1| hypothetical protein POPTR_0006s22920g [Popu... 66 5e-09 ref|XP_002530319.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 gb|EXB88691.1| Uncharacterized protein L484_015376 [Morus notabi... 63 5e-08 ref|XP_006481760.1| PREDICTED: uncharacterized protein At3g28850... 63 5e-08 ref|XP_002323426.2| hypothetical protein POPTR_0016s08030g [Popu... 62 6e-08 emb|CBI30303.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002276568.1| PREDICTED: uncharacterized protein At5g39865... 62 1e-07 ref|XP_006855070.1| hypothetical protein AMTR_s00031p00132350 [A... 61 2e-07 ref|XP_006430185.1| hypothetical protein CICLE_v10011852mg [Citr... 59 5e-07 ref|XP_004149222.1| PREDICTED: uncharacterized protein At5g39865... 57 3e-06 ref|XP_003554438.1| PREDICTED: uncharacterized protein At5g39865... 57 3e-06 gb|EOY08261.1| Glutaredoxin family protein, putative [Theobroma ... 56 4e-06 ref|XP_004494189.1| PREDICTED: uncharacterized protein At5g39865... 56 4e-06 gb|ESW34903.1| hypothetical protein PHAVU_001G190600g [Phaseolus... 56 6e-06 gb|AFK41682.1| unknown [Medicago truncatula] 55 7e-06 ref|XP_003625833.1| hypothetical protein MTR_7g104720 [Medicago ... 55 7e-06 gb|ABK24666.1| unknown [Picea sitchensis] 55 7e-06 >gb|EMJ05583.1| hypothetical protein PRUPE_ppa006757mg [Prunus persica] Length = 396 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE K MV+CGECNENGLIHCPICC Sbjct: 366 GSCKVLDEGQKKMVKCGECNENGLIHCPICC 396 >ref|XP_004305334.1| PREDICTED: uncharacterized protein At5g39865-like [Fragaria vesca subsp. vesca] Length = 380 Score = 67.8 bits (164), Expect = 1e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE+ K MV+CGECNENGLIHCP+CC Sbjct: 350 GSCKVLDEAQKKMVKCGECNENGLIHCPLCC 380 >ref|XP_002309426.1| hypothetical protein POPTR_0006s22920g [Populus trichocarpa] gi|222855402|gb|EEE92949.1| hypothetical protein POPTR_0006s22920g [Populus trichocarpa] Length = 407 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE K MVRCGECNENGLI CPICC Sbjct: 377 GSCKVLDEMQKKMVRCGECNENGLIQCPICC 407 >ref|XP_002530319.1| conserved hypothetical protein [Ricinus communis] gi|223530123|gb|EEF32035.1| conserved hypothetical protein [Ricinus communis] Length = 427 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLD K MV+CGECNENGLI CPICC Sbjct: 397 GSCKVLDNEQKKMVKCGECNENGLIQCPICC 427 >gb|EXB88691.1| Uncharacterized protein L484_015376 [Morus notabilis] Length = 413 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPIC 335 GSCKVLDE K MVRCG CNENGL+HCPIC Sbjct: 384 GSCKVLDEQQKKMVRCGGCNENGLVHCPIC 413 >ref|XP_006481760.1| PREDICTED: uncharacterized protein At3g28850-like [Citrus sinensis] Length = 413 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLD K M+RCGECNENGLI CP+CC Sbjct: 383 GSCKVLDGEQKKMIRCGECNENGLIQCPVCC 413 >ref|XP_002323426.2| hypothetical protein POPTR_0016s08030g [Populus trichocarpa] gi|550321084|gb|EEF05187.2| hypothetical protein POPTR_0016s08030g [Populus trichocarpa] Length = 412 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVL E K MVRCGECNENGL+ CPICC Sbjct: 382 GSCKVLHEEQKKMVRCGECNENGLMQCPICC 412 >emb|CBI30303.3| unnamed protein product [Vitis vinifera] Length = 310 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCK+LDE K MV+C ECNENGLI CPICC Sbjct: 280 GSCKLLDEDQKKMVKCSECNENGLIQCPICC 310 >ref|XP_002276568.1| PREDICTED: uncharacterized protein At5g39865-like [Vitis vinifera] Length = 398 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCK+LDE K MV+C ECNENGLI CPICC Sbjct: 368 GSCKLLDEDQKKMVKCSECNENGLIQCPICC 398 >ref|XP_006855070.1| hypothetical protein AMTR_s00031p00132350 [Amborella trichopoda] gi|548858799|gb|ERN16537.1| hypothetical protein AMTR_s00031p00132350 [Amborella trichopoda] Length = 389 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKV D+ NK +VRCG+CNENGLIHCPICC Sbjct: 360 GSCKVRDDENK-VVRCGDCNENGLIHCPICC 389 >ref|XP_006430185.1| hypothetical protein CICLE_v10011852mg [Citrus clementina] gi|557532242|gb|ESR43425.1| hypothetical protein CICLE_v10011852mg [Citrus clementina] Length = 413 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLD K M+RC ECNENGLI CP+CC Sbjct: 383 GSCKVLDGEQKKMIRCVECNENGLIQCPVCC 413 >ref|XP_004149222.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus] gi|449522666|ref|XP_004168347.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus] Length = 397 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPIC 335 GSCKVLD++ K +CGECNENGLI CPIC Sbjct: 367 GSCKVLDQTKKKTTKCGECNENGLIRCPIC 396 >ref|XP_003554438.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] Length = 398 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPIC 335 GSCKVLDE K +RCG+CNENGLI CP+C Sbjct: 368 GSCKVLDEDRKKTLRCGQCNENGLIQCPMC 397 >gb|EOY08261.1| Glutaredoxin family protein, putative [Theobroma cacao] Length = 389 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLD K +RCGECNENGL+ CPICC Sbjct: 360 GSCKVLDGDQKK-IRCGECNENGLVQCPICC 389 >ref|XP_004494189.1| PREDICTED: uncharacterized protein At5g39865-like [Cicer arietinum] Length = 398 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE K V+CG CNENG+I C ICC Sbjct: 368 GSCKVLDEKQKKTVKCGYCNENGIIRCAICC 398 >gb|ESW34903.1| hypothetical protein PHAVU_001G190600g [Phaseolus vulgaris] Length = 391 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPIC 335 GSCKVLDE K VRCG CNENGL+ CP+C Sbjct: 361 GSCKVLDEECKKNVRCGHCNENGLVQCPLC 390 >gb|AFK41682.1| unknown [Medicago truncatula] Length = 405 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE K V+CG CNENG+I C +CC Sbjct: 375 GSCKVLDEKQKKTVKCGYCNENGIIRCSLCC 405 >ref|XP_003625833.1| hypothetical protein MTR_7g104720 [Medicago truncatula] gi|355500848|gb|AES82051.1| hypothetical protein MTR_7g104720 [Medicago truncatula] Length = 405 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCKVLDE K V+CG CNENG+I C +CC Sbjct: 375 GSCKVLDEKQKKTVKCGYCNENGIIRCSLCC 405 >gb|ABK24666.1| unknown [Picea sitchensis] Length = 497 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 424 GSCKVLDESNKSMVRCGECNENGLIHCPICC 332 GSCK++DE N S+VRC +CNENGLI CPICC Sbjct: 468 GSCKLVDEDN-SVVRCPDCNENGLIQCPICC 497