BLASTX nr result
ID: Achyranthes22_contig00042650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00042650 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492603.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006420841.1| hypothetical protein CICLE_v10006919mg [Citr... 59 7e-07 gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] 59 9e-07 ref|NP_568214.1| pentatricopeptide repeat-containing protein [Ar... 58 1e-06 gb|AAM64472.1| unknown [Arabidopsis thaliana] 58 1e-06 emb|CAC05471.1| putative protein [Arabidopsis thaliana] 58 1e-06 ref|XP_006399423.1| hypothetical protein EUTSA_v10013686mg [Eutr... 56 4e-06 ref|XP_004290423.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_002268952.2| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 emb|CBI40661.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Caps... 55 1e-05 ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Caps... 55 1e-05 >ref|XP_006492603.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Citrus sinensis] Length = 408 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++FR+ +++W++EGN A ++ELR I + LRKSQRYKHALE Sbjct: 56 DDLKSRIFRISLPKRSAINVIQRWVSEGNQATVSELRHILKELRKSQRYKHALE 109 >ref|XP_006420841.1| hypothetical protein CICLE_v10006919mg [Citrus clementina] gi|557522714|gb|ESR34081.1| hypothetical protein CICLE_v10006919mg [Citrus clementina] Length = 377 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++FR+ +++W++EGN A ++ELR I + LRKSQRYKHALE Sbjct: 35 DDLKSRIFRISLPKRSATNVIQRWVSEGNQATVSELRHILKELRKSQRYKHALE 88 >gb|EXB57865.1| hypothetical protein L484_001062 [Morus notabilis] Length = 203 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/55 (52%), Positives = 40/55 (72%), Gaps = 10/55 (18%) Frame = -1 Query: 135 ADDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 +DD+KS++FRL L++WI+EGN +++ELRQI + LRKS RYKHALE Sbjct: 139 SDDVKSRIFRLRLPKRSATNVLQRWISEGNQISISELRQISKDLRKSHRYKHALE 193 >ref|NP_568214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75165070|sp|Q94B59.1|PP372_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g09450, mitochondrial; Flags: Precursor gi|14596093|gb|AAK68774.1| putative protein [Arabidopsis thaliana] gi|27311913|gb|AAO00922.1| putative protein [Arabidopsis thaliana] gi|332004012|gb|AED91395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 409 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALE 108 >gb|AAM64472.1| unknown [Arabidopsis thaliana] Length = 409 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALE 108 >emb|CAC05471.1| putative protein [Arabidopsis thaliana] Length = 402 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++FRL LEKWI EGN + ELR+I + LR+++RYKHALE Sbjct: 55 DDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYKHALE 108 >ref|XP_006399423.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum] gi|557100513|gb|ESQ40876.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum] Length = 410 Score = 56.2 bits (134), Expect = 4e-06 Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 10/103 (9%) Frame = -1 Query: 279 RTIITTTYTKSNLNLNSKFKAFSSSTSDALSXXXXXXXXXEFSHLTQLADDLKSQLFRL- 103 R +T +SN N++ FS S S A + F + + DDL+S++FRL Sbjct: 11 RCRLTNGVFESNFIRNAEASLFSKSYS-ADTAIGSSFVEESFDSVEK--DDLRSRIFRLR 67 Query: 102 ---------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 LEKW EGN ++TELR I R L++++RYKHALE Sbjct: 68 LPKRSATTVLEKWAGEGNQISVTELRYISRELKRTRRYKHALE 110 >ref|XP_004290423.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 385 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 10/59 (16%) Frame = -1 Query: 147 LTQLADDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 L+Q DDLKS++ R+ LE+W+++GN ++ELRQI + LR SQR+KHALE Sbjct: 30 LSQEIDDLKSRILRVRLPKRSVTNVLERWVHQGNQITISELRQISKELRMSQRHKHALE 88 >ref|XP_002268952.2| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Vitis vinifera] Length = 396 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++F+L L++W+ EGN +++ELR I + LR++QRYKHALE Sbjct: 44 DDLKSRIFKLRLPKRSVTNVLQRWLGEGNQVHISELRNISKELRRAQRYKHALE 97 >emb|CBI40661.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDLKS++F+L L++W+ EGN +++ELR I + LR++QRYKHALE Sbjct: 51 DDLKSRIFKLRLPKRSVTNVLQRWLGEGNQVHISELRNISKELRRAQRYKHALE 104 >ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556557|gb|EOA20749.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 412 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDL+S++FRL LEKW+ EGN + ELR I + LR+++RYKHALE Sbjct: 59 DDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELRDISKELRRTRRYKHALE 112 >ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556556|gb|EOA20748.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 401 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 10/54 (18%) Frame = -1 Query: 132 DDLKSQLFRL----------LEKWINEGNYANLTELRQICRVLRKSQRYKHALE 1 DDL+S++FRL LEKW+ EGN + ELR I + LR+++RYKHALE Sbjct: 48 DDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELRDISKELRRTRRYKHALE 101