BLASTX nr result
ID: Achyranthes22_contig00042529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00042529 (282 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV30692.1| kinase-like protein [Prunus avium] 70 4e-10 gb|EOY11018.1| Serine-threonine protein kinase, plant-type, puta... 69 5e-10 ref|XP_006657081.1| PREDICTED: LRR receptor-like serine/threonin... 69 6e-10 ref|XP_006495155.1| PREDICTED: probable LRR receptor-like serine... 69 6e-10 ref|XP_006495009.1| PREDICTED: uncharacterized protein LOC102608... 69 6e-10 ref|XP_006484590.1| PREDICTED: probable LRR receptor-like serine... 69 6e-10 ref|XP_006484589.1| PREDICTED: uncharacterized protein LOC102625... 69 6e-10 ref|XP_006484587.1| PREDICTED: probable LRR receptor-like serine... 69 6e-10 ref|XP_006437547.1| hypothetical protein CICLE_v10033496mg, part... 69 6e-10 ref|XP_006437536.1| hypothetical protein CICLE_v10033311mg [Citr... 69 6e-10 ref|XP_006484680.1| PREDICTED: probable LRR receptor-like serine... 69 8e-10 ref|XP_006484593.1| PREDICTED: probable LRR receptor-like serine... 69 8e-10 ref|XP_006371567.1| hypothetical protein POPTR_0019s13220g [Popu... 69 8e-10 ref|XP_004305136.1| PREDICTED: probable LRR receptor-like serine... 69 8e-10 ref|XP_002528848.1| serine-threonine protein kinase, plant-type,... 69 8e-10 gb|ACI05911.1| kinase-like protein pac.x.6.108 [Platanus x aceri... 69 8e-10 gb|ABV54850.1| kinase-like protein [Prunus serrulata] 69 8e-10 gb|ABV54838.1| kinase-like protein [Prunus serrulata] 69 8e-10 gb|ABV54821.1| kinase-like protein [Prunus serrulata] 69 8e-10 ref|XP_006484594.1| PREDICTED: probable LRR receptor-like serine... 68 1e-09 >gb|ABV30692.1| kinase-like protein [Prunus avium] Length = 173 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -1 Query: 273 NLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 +LNL+QRLDIA+DVA+AL+YLH+H + IVHCDLKPSN+LL Sbjct: 94 SLNLEQRLDIAIDVAYALDYLHNHCETPIVHCDLKPSNVLL 134 >gb|EOY11018.1| Serine-threonine protein kinase, plant-type, putative [Theobroma cacao] Length = 1039 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 282 ITRNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 + RNLNL QRL++A+DV ALEYLHH+ + IVHCDLKPSNILL Sbjct: 814 VARNLNLLQRLNVAIDVGCALEYLHHYCETPIVHCDLKPSNILL 857 >ref|XP_006657081.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase EFR-like [Oryza brachyantha] Length = 1149 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 R LNL +R+DI +DVA ALEYLHHH A IVHCDLKPSNILL Sbjct: 940 RVLNLSERIDITIDVACALEYLHHHKPAPIVHCDLKPSNILL 981 >ref|XP_006495155.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like, partial [Citrus sinensis] Length = 840 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 781 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 822 >ref|XP_006495009.1| PREDICTED: uncharacterized protein LOC102608416 [Citrus sinensis] Length = 1313 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 1152 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 1193 >ref|XP_006484590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Citrus sinensis] Length = 483 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 261 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 302 >ref|XP_006484589.1| PREDICTED: uncharacterized protein LOC102625372 [Citrus sinensis] Length = 1258 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 1036 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 1077 >ref|XP_006484587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Citrus sinensis] Length = 979 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 757 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 798 >ref|XP_006437547.1| hypothetical protein CICLE_v10033496mg, partial [Citrus clementina] gi|557539743|gb|ESR50787.1| hypothetical protein CICLE_v10033496mg, partial [Citrus clementina] Length = 676 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 634 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 675 >ref|XP_006437536.1| hypothetical protein CICLE_v10033311mg [Citrus clementina] gi|557539732|gb|ESR50776.1| hypothetical protein CICLE_v10033311mg [Citrus clementina] Length = 947 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL+IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 725 RNLNLLQRLNIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 766 >ref|XP_006484680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Citrus sinensis] Length = 1054 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 756 RNLNLLQRLSIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 797 >ref|XP_006484593.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Citrus sinensis] Length = 833 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL IAVDVA AL+YLHH+ + IVHCDLKPSN+LL Sbjct: 611 RNLNLLQRLSIAVDVASALDYLHHYCETPIVHCDLKPSNVLL 652 >ref|XP_006371567.1| hypothetical protein POPTR_0019s13220g [Populus trichocarpa] gi|550317446|gb|ERP49364.1| hypothetical protein POPTR_0019s13220g [Populus trichocarpa] Length = 638 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 R+LNL QRLDI++DVA AL+YLHHH IVHCDLKPSN+LL Sbjct: 409 RSLNLTQRLDISIDVANALDYLHHHCHTPIVHCDLKPSNVLL 450 >ref|XP_004305136.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Fragaria vesca subsp. vesca] Length = 1044 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 R L+LQQRL+IA+DVA AL+YLHHH + IVHCDLKPSNILL Sbjct: 827 RMLSLQQRLNIAIDVASALDYLHHHCEDQIVHCDLKPSNILL 868 >ref|XP_002528848.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223531699|gb|EEF33522.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 484 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 282 ITRNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 + R LN+ QRL IA+D+A ALEYLHHH + IVHCDLKPSN+LL Sbjct: 350 VRRTLNILQRLKIAIDIACALEYLHHHCETPIVHCDLKPSNVLL 393 >gb|ACI05911.1| kinase-like protein pac.x.6.108 [Platanus x acerifolia] Length = 167 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 282 ITRNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 + +NL+ QRL+IA+DVAF L+YLHHH IVHCDLKPSNILL Sbjct: 86 LLKNLSFSQRLNIAIDVAFTLDYLHHHCQTPIVHCDLKPSNILL 129 >gb|ABV54850.1| kinase-like protein [Prunus serrulata] Length = 159 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 +NL+L QRLDIA+DVA+AL+YLH+H + IVHCDLKPSN+LL Sbjct: 86 KNLSLVQRLDIAMDVAYALDYLHNHCETQIVHCDLKPSNVLL 127 >gb|ABV54838.1| kinase-like protein [Prunus serrulata] Length = 166 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 +NL+L QRLDIA+DVA+AL+YLH+H + IVHCDLKPSN+LL Sbjct: 86 KNLSLVQRLDIAMDVAYALDYLHNHCETQIVHCDLKPSNVLL 127 >gb|ABV54821.1| kinase-like protein [Prunus serrulata] Length = 168 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 270 LNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 LNL+QRLDIA+DVA AL+YLH+H + IVHCDLKPSN+LL Sbjct: 90 LNLEQRLDIAIDVACALDYLHNHSETPIVHCDLKPSNVLL 129 >ref|XP_006484594.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Citrus sinensis] Length = 1029 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 276 RNLNLQQRLDIAVDVAFALEYLHHHGDASIVHCDLKPSNILL 151 RNLNL QRL IAVDVA LEYLHH+ + IVHCDLKPSN+LL Sbjct: 807 RNLNLLQRLSIAVDVASTLEYLHHYCETPIVHCDLKPSNVLL 848