BLASTX nr result
ID: Achyranthes22_contig00041966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00041966 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHF21578.1| late embryogenesis abundant protein [Tamarix hisp... 55 1e-05 >gb|AHF21578.1| late embryogenesis abundant protein [Tamarix hispida] Length = 584 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 3 GSSLWWVRAVTEFLGILYSSPYMHKQTKVDV 95 GSSLWWVRAV EFLG+LYSS Y+H Q K+ V Sbjct: 402 GSSLWWVRAVNEFLGVLYSSQYLHTQKKIQV 432