BLASTX nr result
ID: Achyranthes22_contig00040982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00040982 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006438553.1| hypothetical protein CICLE_v10031206mg [Citr... 57 2e-06 gb|EPS65019.1| hypothetical protein M569_09759, partial [Genlise... 56 4e-06 >ref|XP_006438553.1| hypothetical protein CICLE_v10031206mg [Citrus clementina] gi|568859474|ref|XP_006483264.1| PREDICTED: uncharacterized protein LOC102620471 [Citrus sinensis] gi|557540749|gb|ESR51793.1| hypothetical protein CICLE_v10031206mg [Citrus clementina] Length = 531 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 NGKLYPLRLQLPPNSTTMHIVVVPSTSTLAQEFL 102 NGKLYPLRLQLPPN++ MH++VVP +S +A+EFL Sbjct: 491 NGKLYPLRLQLPPNNSDMHVIVVPQSSKVAREFL 524 >gb|EPS65019.1| hypothetical protein M569_09759, partial [Genlisea aurea] Length = 279 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 NGKLYPLRLQLPPNSTTMHIVVVPSTSTLAQEFL 102 NGKLYPLRL LPPN+ TMH+VVVP +S A EFL Sbjct: 244 NGKLYPLRLALPPNNATMHVVVVPPSSNAANEFL 277