BLASTX nr result
ID: Achyranthes22_contig00040179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00040179 (276 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490578.1| PREDICTED: putative disease resistance prote... 56 4e-06 ref|XP_004490577.1| PREDICTED: putative disease resistance prote... 56 4e-06 ref|XP_002519373.1| leucine-rich repeat containing protein, puta... 56 6e-06 >ref|XP_004490578.1| PREDICTED: putative disease resistance protein RGA1-like isoform X2 [Cicer arietinum] Length = 1014 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 169 LPEWIGCFSTLEILQIHFI-GIKSLPESIKDLTSLKEATISGTSKLEKRCENPNGED 2 LPE I ++LE+L IH G++SLPE I+ LTSL+ TI G S L+KRCE GED Sbjct: 945 LPEGIRHLTSLEVLTIHGCEGLRSLPEGIRHLTSLEVLTIHGCSTLKKRCEKEIGED 1001 >ref|XP_004490577.1| PREDICTED: putative disease resistance protein RGA1-like isoform X1 [Cicer arietinum] Length = 1042 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 169 LPEWIGCFSTLEILQIHFI-GIKSLPESIKDLTSLKEATISGTSKLEKRCENPNGED 2 LPE I ++LE+L IH G++SLPE I+ LTSL+ TI G S L+KRCE GED Sbjct: 973 LPEGIRHLTSLEVLTIHGCEGLRSLPEGIRHLTSLEVLTIHGCSTLKKRCEKEIGED 1029 >ref|XP_002519373.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223541440|gb|EEF42990.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1208 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -3 Query: 175 SLLPEWIGCFSTLEILQIHFIG-IKSLPESIKDLTSLKEATISGTSKLEKRCENPNGED 2 S LPEWIG S+L+ L+I +I + SLP+SI+ L +L++ I KL KRC P G D Sbjct: 1129 STLPEWIGSLSSLQRLKISYISRLTSLPDSIRALAALQQLRICNCPKLSKRCRKPTGAD 1187