BLASTX nr result
ID: Achyranthes22_contig00039941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039941 (612 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 57 3e-12 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 56.6 bits (135), Expect(2) = 3e-12 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +1 Query: 454 EERRVGLAALYMFDKAETWATSYTATRHHVLWYDFVIDLVIRFKDDTISNVVE 612 ++++V LA+L M DKAE W +SY R V W DFVID+ RFKD++ NVVE Sbjct: 63 DKQKVDLASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDESGINVVE 115 Score = 41.2 bits (95), Expect(2) = 3e-12 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +3 Query: 366 PKLKFPKFNGEHTRTWIKKICHY 434 PKLKFPKF+G + R WIKK C Y Sbjct: 33 PKLKFPKFDGSNLRQWIKKCCKY 55