BLASTX nr result
ID: Achyranthes22_contig00039929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039929 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265112.1| PREDICTED: carboxypeptidase D [Vitis vinifer... 60 3e-07 gb|ESW15573.1| hypothetical protein PHAVU_007G083600g [Phaseolus... 56 4e-06 >ref|XP_002265112.1| PREDICTED: carboxypeptidase D [Vitis vinifera] gi|296083126|emb|CBI22762.3| unnamed protein product [Vitis vinifera] Length = 493 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 9/68 (13%) Frame = +3 Query: 294 PVFGRGGAQSSEIPG---------RRLLDDVHSEPSNKEATEGYMSNTDLENAIMEFGER 446 P F RGG +S + G R L +V+ ++ + + GYM+N+DLE A+ EFG R Sbjct: 23 PAFARGGQRSPKFSGVMDDSYVGNGRRLSEVNHSKASVDVSRGYMTNSDLEKAVKEFGRR 82 Query: 447 CSNISRIY 470 CSNISRIY Sbjct: 83 CSNISRIY 90 >gb|ESW15573.1| hypothetical protein PHAVU_007G083600g [Phaseolus vulgaris] Length = 494 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 339 RRLLDDVHSEPSNKEATEGYMSNTDLENAIMEFGERCSNISRIY 470 R LL+D ++ + +GYMSN DLE AI EFG+RCSNISRIY Sbjct: 47 RHLLEDESRAQTSVDLAQGYMSNDDLERAIKEFGQRCSNISRIY 90