BLASTX nr result
ID: Achyranthes22_contig00039511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039511 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361409.1| PREDICTED: probable serine/threonine protein... 81 2e-13 ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphat... 80 3e-13 gb|EPS71035.1| hypothetical protein M569_03725 [Genlisea aurea] 79 7e-13 gb|EPS71483.1| hypothetical protein M569_03272, partial [Genlise... 79 1e-12 emb|CBI22372.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002269177.1| PREDICTED: serine/threonine-protein phosphat... 77 3e-12 gb|AEQ28761.1| calcium ion binding protein [Prunus salicina] 71 2e-10 gb|EOY06069.1| Calcium-binding EF-hand family protein isoform 4 ... 70 3e-10 gb|EOY06068.1| Calcium-binding EF-hand family protein isoform 3 ... 70 3e-10 gb|EOY06066.1| Calcium-binding EF-hand family protein isoform 1 ... 70 3e-10 gb|EMJ09661.1| hypothetical protein PRUPE_ppa003942mg [Prunus pe... 70 4e-10 ref|XP_004152820.1| PREDICTED: serine/threonine-protein phosphat... 70 5e-10 ref|XP_006345898.1| PREDICTED: probable serine/threonine protein... 69 7e-10 ref|XP_006345897.1| PREDICTED: probable serine/threonine protein... 69 7e-10 emb|CDK13062.1| putative predicted protein [Malus domestica] 69 9e-10 ref|XP_004302093.1| PREDICTED: serine/threonine-protein phosphat... 69 9e-10 ref|XP_004289966.1| PREDICTED: serine/threonine-protein phosphat... 69 9e-10 ref|XP_004239749.1| PREDICTED: serine/threonine-protein phosphat... 69 9e-10 emb|CDK13061.1| putative predicted protein [Malus domestica] 69 1e-09 gb|EOY10902.1| Calcium-binding EF-hand family protein isoform 5 ... 69 1e-09 >ref|XP_006361409.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Solanum tuberosum] Length = 539 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 MD+DFNGD SLDAELLQLPE+SPLA+K+NP++A+ LF+QWLSLP+T L Sbjct: 1 MDVDFNGDVASLDAELLQLPELSPLAIKTNPFVAEKLFDQWLSLPDTTAL 50 >ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Solanum lycopersicum] Length = 539 Score = 80.5 bits (197), Expect = 3e-13 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 MD+DFNGD SLDAELLQLPE+SPLA+K+NP++A+ LF+QWLSLP+T L Sbjct: 1 MDVDFNGDVASLDAELLQLPELSPLAIKTNPFVAEKLFDQWLSLPDTAAL 50 >gb|EPS71035.1| hypothetical protein M569_03725 [Genlisea aurea] Length = 539 Score = 79.3 bits (194), Expect = 7e-13 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETN 9 MD+DFNGD S DAELLQ+PEVSPLA+K+NPY+ + LF+QWL +PETN Sbjct: 1 MDLDFNGDVPSFDAELLQIPEVSPLAIKTNPYVGEKLFDQWLGVPETN 48 >gb|EPS71483.1| hypothetical protein M569_03272, partial [Genlisea aurea] Length = 551 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -1 Query: 170 IDSLL*MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 + LL MD+DFNGD S DAELLQLPEVSPLA+K+NP++A+ LF+QWLS+ +T + Sbjct: 7 LSDLLVMDLDFNGDVASFDAELLQLPEVSPLAIKANPFVAEKLFDQWLSIHDTTSM 62 >emb|CBI22372.3| unnamed protein product [Vitis vinifera] Length = 211 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+M+ D +SLDAELLQLPEVSP ALKSNP +++LF+QWLSLPETNRL Sbjct: 1 MNMEIVSDVLSLDAELLQLPEVSPFALKSNPRFSEELFDQWLSLPETNRL 50 >ref|XP_002269177.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Vitis vinifera] Length = 539 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+M+ D +SLDAELLQLPEVSP ALKSNP +++LF+QWLSLPETNRL Sbjct: 1 MNMEIVSDVLSLDAELLQLPEVSPFALKSNPRFSEELFDQWLSLPETNRL 50 >gb|AEQ28761.1| calcium ion binding protein [Prunus salicina] Length = 539 Score = 71.2 bits (173), Expect = 2e-10 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M M+ D S DAELLQL EVSPLALKSNP + LFEQWLSLPETNRL Sbjct: 1 MSMEIAVDAASFDAELLQLTEVSPLALKSNPSYVESLFEQWLSLPETNRL 50 >gb|EOY06069.1| Calcium-binding EF-hand family protein isoform 4 [Theobroma cacao] Length = 420 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+++ GD SLD + LQLPE+SPLALKSNP+LA++LF WLSLPET RL Sbjct: 1 MEVEAVGDVASLDPDSLQLPELSPLALKSNPFLAEELFSLWLSLPETGRL 50 >gb|EOY06068.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao] Length = 485 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+++ GD SLD + LQLPE+SPLALKSNP+LA++LF WLSLPET RL Sbjct: 1 MEVEAVGDVASLDPDSLQLPELSPLALKSNPFLAEELFSLWLSLPETGRL 50 >gb|EOY06066.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] gi|508714170|gb|EOY06067.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] Length = 536 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+++ GD SLD + LQLPE+SPLALKSNP+LA++LF WLSLPET RL Sbjct: 1 MEVEAVGDVASLDPDSLQLPELSPLALKSNPFLAEELFSLWLSLPETGRL 50 >gb|EMJ09661.1| hypothetical protein PRUPE_ppa003942mg [Prunus persica] Length = 539 Score = 70.1 bits (170), Expect = 4e-10 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M M+ D S D+ELLQL EVSPLALKSNP + LFEQWLSLPETNRL Sbjct: 1 MSMEIAVDAASFDSELLQLTEVSPLALKSNPSYVESLFEQWLSLPETNRL 50 >ref|XP_004152820.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Cucumis sativus] Length = 539 Score = 69.7 bits (169), Expect = 5e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+M+ + D SLDAELLQL EVSPL++KSNP + LFEQWLSLP TNRL Sbjct: 1 MNMEISCDVASLDAELLQLAEVSPLSIKSNPDFVEKLFEQWLSLPGTNRL 50 >ref|XP_006345898.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like isoform X2 [Solanum tuberosum] Length = 539 Score = 69.3 bits (168), Expect = 7e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 MD+D GD LDAELLQLP+VS A+K NP++AQ LF+QWLSLP+T L Sbjct: 1 MDVDLIGDVARLDAELLQLPDVSSFAIKDNPFVAQKLFDQWLSLPDTTPL 50 >ref|XP_006345897.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like isoform X1 [Solanum tuberosum] Length = 540 Score = 69.3 bits (168), Expect = 7e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 MD+D GD LDAELLQLP+VS A+K NP++AQ LF+QWLSLP+T L Sbjct: 1 MDVDLIGDVARLDAELLQLPDVSSFAIKDNPFVAQKLFDQWLSLPDTTPL 50 >emb|CDK13062.1| putative predicted protein [Malus domestica] Length = 539 Score = 68.9 bits (167), Expect = 9e-10 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M M+ D S DAELLQL EVSPLALKSNP Q LF+QWLSLP+TNRL Sbjct: 1 MTMEIVVDAASFDAELLQLNEVSPLALKSNPSYVQSLFDQWLSLPDTNRL 50 >ref|XP_004302093.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Fragaria vesca subsp. vesca] Length = 540 Score = 68.9 bits (167), Expect = 9e-10 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 134 GDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 GD + DAELLQL EVSPLALK+NP + LFEQWLSLPETNRL Sbjct: 8 GDVAAFDAELLQLNEVSPLALKANPSFVESLFEQWLSLPETNRL 51 >ref|XP_004289966.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Fragaria vesca subsp. vesca] Length = 540 Score = 68.9 bits (167), Expect = 9e-10 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 152 MDMD-FNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 MD+D GD SLD ELLQLPE+SP ALK++P +A DLF QWLSLP+T RL Sbjct: 1 MDIDAVAGDITSLDPELLQLPELSPFALKASPQIADDLFSQWLSLPQTGRL 51 >ref|XP_004239749.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Solanum lycopersicum] Length = 539 Score = 68.9 bits (167), Expect = 9e-10 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -1 Query: 152 MDMDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPET 12 MD+D GD LDAELLQLP+VS A+K NP++AQ LF+QWLSLP+T Sbjct: 1 MDVDLIGDLARLDAELLQLPDVSSFAIKDNPFVAQKLFDQWLSLPDT 47 >emb|CDK13061.1| putative predicted protein [Malus domestica] Length = 389 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -1 Query: 146 MDFNGDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 M+ D S DAELLQL EVSPLALKSNP Q LFEQWLSLP+TNRL Sbjct: 1 MEIVVDAASFDAELLQLNEVSPLALKSNPSYVQSLFEQWLSLPDTNRL 48 >gb|EOY10902.1| Calcium-binding EF-hand family protein isoform 5 [Theobroma cacao] Length = 402 Score = 68.6 bits (166), Expect = 1e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 134 GDFISLDAELLQLPEVSPLALKSNPYLAQDLFEQWLSLPETNRL 3 GD LDAELLQL E+SPLALKSNP Q LFEQWLSLP+TN+L Sbjct: 7 GDVACLDAELLQLQEMSPLALKSNPEFTQKLFEQWLSLPDTNKL 50