BLASTX nr result
ID: Achyranthes22_contig00039509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039509 (520 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55981.1| Long chain acyl-CoA synthetase 1 [Morus notabilis] 55 3e-07 ref|XP_004288548.1| PREDICTED: long chain acyl-CoA synthetase 1-... 50 3e-06 ref|XP_003535896.1| PREDICTED: long chain acyl-CoA synthetase 1-... 50 6e-06 ref|XP_003518711.1| PREDICTED: long chain acyl-CoA synthetase 1-... 50 8e-06 >gb|EXB55981.1| Long chain acyl-CoA synthetase 1 [Morus notabilis] Length = 604 Score = 55.1 bits (131), Expect(2) = 3e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 272 CNRSELLSVFFRNKPGPGAINYIIDHAEIDYVFVQADKVKEV 147 CN L+ V + GPGA+N+IIDHAE+DYVFVQ KVKE+ Sbjct: 121 CNAHSLICVPLYDTLGPGAVNFIIDHAEVDYVFVQDKKVKEL 162 Score = 25.0 bits (53), Expect(2) = 3e-07 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 43 QLLDPDCSSTKRLK 2 +LL+PDC S++RLK Sbjct: 161 ELLNPDCGSSQRLK 174 >ref|XP_004288548.1| PREDICTED: long chain acyl-CoA synthetase 1-like [Fragaria vesca subsp. vesca] Length = 661 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 272 CNRSELLSVFFRNKPGPGAINYIIDHAEIDYVFVQADKVKEV 147 CN L+ V + GPGA+N+IIDHAE+D VF+Q KVK++ Sbjct: 121 CNAHSLICVPLYDTLGPGAVNFIIDHAEVDVVFIQDKKVKQL 162 Score = 26.2 bits (56), Expect(2) = 3e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -1 Query: 43 QLLDPDCSSTKRLK 2 QLL PDC+S++RLK Sbjct: 161 QLLSPDCTSSQRLK 174 >ref|XP_003535896.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X1 [Glycine max] gi|571481120|ref|XP_006588558.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X2 [Glycine max] gi|571481123|ref|XP_006588559.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X3 [Glycine max] gi|571481125|ref|XP_006588560.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X4 [Glycine max] Length = 660 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 272 CNRSELLSVFFRNKPGPGAINYIIDHAEIDYVFVQADKVKEV 147 C+ + V + GPGA+N+IIDHAE+D+VFVQ KVKE+ Sbjct: 121 CSAQSFICVPLYDTLGPGAVNFIIDHAEVDFVFVQDKKVKEL 162 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 43 QLLDPDCSSTKRLK 2 +LL+P+C S+KRLK Sbjct: 161 ELLNPECKSSKRLK 174 >ref|XP_003518711.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X1 [Glycine max] gi|571438270|ref|XP_006574527.1| PREDICTED: long chain acyl-CoA synthetase 1-like isoform X2 [Glycine max] Length = 660 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 272 CNRSELLSVFFRNKPGPGAINYIIDHAEIDYVFVQADKVKEV 147 C+ + V + GPGA+N+IIDHAE+D+VFVQ KVKE+ Sbjct: 121 CSAQSFVCVPLYDTLGPGAVNFIIDHAEVDFVFVQDKKVKEL 162 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 43 QLLDPDCSSTKRLK 2 +LL+P+C S+KRLK Sbjct: 161 ELLNPECKSSKRLK 174