BLASTX nr result
ID: Achyranthes22_contig00039158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039158 (496 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT18051.1| Putative serine/threonine-protein kinase [Aegilop... 38 5e-06 >gb|EMT18051.1| Putative serine/threonine-protein kinase [Aegilops tauschii] Length = 763 Score = 38.1 bits (87), Expect(2) = 5e-06 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = +2 Query: 44 FTLKFIKTSISQGEQYILALCFW---TYDNENPIVVWSANQDNPV 169 + L F T S +Y A+C + +++ +N +VVWSAN+D PV Sbjct: 55 YNLSFAATIYSHYHKYFFAICVFAPGSWNRDNVVVVWSANRDRPV 99 Score = 37.7 bits (86), Expect(2) = 5e-06 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +3 Query: 174 TSERVLVLRDGNGTDVWSIKASNLLVETSDLSVESMNLKNDGNLVLLNRSGDTIW 338 T++ LVLRD +G+ VWS TS S+ M + GNLVL N +W Sbjct: 108 TADGDLVLRDSDGSLVWS-------TNTSGQSIIGMKITESGNLVLFNHKNLPVW 155