BLASTX nr result
ID: Achyranthes22_contig00039106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00039106 (267 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] 56 4e-06 >emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] Length = 235 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 146 MEIYSYPSRQMASFSSSTLYNLGEKVRGILSFAVSVTLGS 265 ME YSYPS+++AS SSS L +LGEK+RG LSFAVSVTLGS Sbjct: 1 MEFYSYPSQRIAS-SSSILCDLGEKIRGTLSFAVSVTLGS 39