BLASTX nr result
ID: Achyranthes22_contig00038947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00038947 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004294758.1| PREDICTED: probable WRKY transcription facto... 55 1e-05 >ref|XP_004294758.1| PREDICTED: probable WRKY transcription factor 33-like [Fragaria vesca subsp. vesca] Length = 627 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 139 VPKFKSLPPPHIPISAPLVSSSSYFALPPG 50 VPKFKSLPPP +PIS P VS SSYFA+PPG Sbjct: 65 VPKFKSLPPPQLPISPPSVSPSSYFAIPPG 94