BLASTX nr result
ID: Achyranthes22_contig00038802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00038802 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC45337.1| hypothetical protein L484_000353 [Morus notabilis] 55 1e-05 gb|EXC25042.1| Transmembrane protein 136 [Morus notabilis] 55 1e-05 >gb|EXC45337.1| hypothetical protein L484_000353 [Morus notabilis] Length = 56 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 236 MAMGLQLVSAFWFYKILQMIQYKLTKRATTKKL 138 MAM LQLVSAFWFYKI +M++YKLTKR+ KKL Sbjct: 23 MAMSLQLVSAFWFYKIARMVKYKLTKRSMPKKL 55 >gb|EXC25042.1| Transmembrane protein 136 [Morus notabilis] Length = 227 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 236 MAMGLQLVSAFWFYKILQMIQYKLTKRATTKKL 138 MAM LQLVSAFWFYKI +M++YKLTKR+ KKL Sbjct: 194 MAMSLQLVSAFWFYKIARMVKYKLTKRSMPKKL 226