BLASTX nr result
ID: Achyranthes22_contig00038617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00038617 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281068.2| PREDICTED: uncharacterized protein LOC100245... 70 2e-10 emb|CBI20829.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_004162491.1| PREDICTED: guanine nucleotide-binding protei... 69 5e-10 ref|XP_004136323.1| PREDICTED: guanine nucleotide-binding protei... 69 5e-10 gb|AFK42580.1| unknown [Lotus japonicus] 66 5e-09 ref|XP_002520348.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_004498598.1| PREDICTED: guanine nucleotide-binding protei... 64 2e-08 ref|XP_006367942.1| PREDICTED: guanine nucleotide-binding protei... 60 2e-07 gb|ESW33283.1| hypothetical protein PHAVU_001G057600g [Phaseolus... 60 3e-07 ref|XP_004244452.1| PREDICTED: guanine nucleotide-binding protei... 60 3e-07 ref|XP_002307445.1| hypothetical protein POPTR_0005s20180g [Popu... 59 7e-07 gb|ABK96688.1| unknown [Populus trichocarpa x Populus deltoides] 59 7e-07 ref|NP_001235320.1| uncharacterized protein LOC100527128 [Glycin... 59 9e-07 ref|XP_002300976.1| hypothetical protein POPTR_0002s08200g [Popu... 59 9e-07 ref|XP_004303443.1| PREDICTED: guanine nucleotide-binding protei... 58 1e-06 ref|XP_006342477.1| PREDICTED: uncharacterized protein LOC102586... 56 6e-06 ref|XP_004253072.1| PREDICTED: guanine nucleotide-binding protei... 56 6e-06 >ref|XP_002281068.2| PREDICTED: uncharacterized protein LOC100245781 [Vitis vinifera] Length = 128 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 + S +ES+PDPLLP T+GPVD++WERWF GA S+SH+RWI Sbjct: 88 LFSSVESIPDPLLPTTQGPVDMSWERWFRGAHESKSHKRWI 128 >emb|CBI20829.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 + S +ES+PDPLLP T+GPVD++WERWF GA S+SH+RWI Sbjct: 35 LFSSVESIPDPLLPTTQGPVDMSWERWFRGAHESKSHKRWI 75 >ref|XP_004162491.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Cucumis sativus] Length = 129 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 254 ISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 IS +ES+PDPLLP T GP DVNW++WF GA SR+HRRWI Sbjct: 90 ISSVESIPDPLLPETIGPTDVNWDQWFRGAHGSRNHRRWI 129 >ref|XP_004136323.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Cucumis sativus] Length = 131 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 254 ISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 IS +ES+PDPLLP T GP DVNW++WF GA SR+HRRWI Sbjct: 92 ISSVESIPDPLLPETIGPTDVNWDQWFRGAHGSRNHRRWI 131 >gb|AFK42580.1| unknown [Lotus japonicus] Length = 114 Score = 65.9 bits (159), Expect = 5e-09 Identities = 26/42 (61%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSR-SHRRWI 135 +IS +ES+PDPLLP TKG +D W+RWFGGA +SR +H+RW+ Sbjct: 73 VISSVESIPDPLLPFTKGSMDAGWDRWFGGAHNSRNNHKRWV 114 >ref|XP_002520348.1| conserved hypothetical protein [Ricinus communis] gi|223540567|gb|EEF42134.1| conserved hypothetical protein [Ricinus communis] Length = 113 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 +IS +ES+PDPLLP++KGP DV+WERWF GA +SR +RWI Sbjct: 75 LISSVESIPDPLLPLSKGPTDVSWERWFRGAHNSR--KRWI 113 >ref|XP_004498598.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cicer arietinum] Length = 126 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 +IS +ES PDP+LP K VD +W+RWFGGA +SR+H+RWI Sbjct: 86 VISSVESKPDPMLPWIKDSVDADWDRWFGGAHNSRNHKRWI 126 >ref|XP_006367942.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Solanum tuberosum] Length = 98 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 254 ISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 IS +ES PD LLP+TKGPVDV W+RWF A+ S+ ++RWI Sbjct: 59 ISVVESKPDALLPVTKGPVDVKWDRWFQRANGSKRNKRWI 98 >gb|ESW33283.1| hypothetical protein PHAVU_001G057600g [Phaseolus vulgaris] Length = 127 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 +IS +ES DPLLP TKG VD W+RWFG R+H+RWI Sbjct: 87 LISSVESTADPLLPCTKGSVDAAWDRWFGSTHHFRNHKRWI 127 >ref|XP_004244452.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Solanum lycopersicum] Length = 127 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 254 ISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 IS +ES PD LLP+TKGP+DV W+RWF A+ S+ ++RWI Sbjct: 88 ISVVESKPDALLPVTKGPIDVKWDRWFQRANGSKRNKRWI 127 >ref|XP_002307445.1| hypothetical protein POPTR_0005s20180g [Populus trichocarpa] gi|222856894|gb|EEE94441.1| hypothetical protein POPTR_0005s20180g [Populus trichocarpa] Length = 120 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 ++S +ES+PDPLLP T+GPV+ +W+RWF G +SR RRWI Sbjct: 82 LLSSVESIPDPLLPSTQGPVNASWDRWFKGNQNSR--RRWI 120 >gb|ABK96688.1| unknown [Populus trichocarpa x Populus deltoides] Length = 120 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 ++S +ES+PDPLLP T+GPV+ +W+RWF G +SR RRWI Sbjct: 82 LLSSVESIPDPLLPSTQGPVNASWDRWFKGNQNSR--RRWI 120 >ref|NP_001235320.1| uncharacterized protein LOC100527128 [Glycine max] gi|255631616|gb|ACU16175.1| unknown [Glycine max] Length = 144 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSR 153 +IS +ES PDPLLP TKG VD W+RWFGGA SR Sbjct: 86 LISSVESTPDPLLPFTKGSVDAGWDRWFGGAHHSR 120 >ref|XP_002300976.1| hypothetical protein POPTR_0002s08200g [Populus trichocarpa] gi|222842702|gb|EEE80249.1| hypothetical protein POPTR_0002s08200g [Populus trichocarpa] Length = 113 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 ++S +ES+PDPLLP T+GPV+ +W+RWF G +SR RRWI Sbjct: 75 LVSGVESIPDPLLPSTQGPVNASWDRWFKGNQNSR--RRWI 113 >ref|XP_004303443.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Fragaria vesca subsp. vesca] Length = 125 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 +++ IESV DPLLP +KG +V W+RWF GA ++RS+ RWI Sbjct: 85 LVASIESVSDPLLPWSKGAPEVGWDRWFRGAHNTRSNNRWI 125 >ref|XP_006342477.1| PREDICTED: uncharacterized protein LOC102586116 [Solanum tuberosum] Length = 180 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/41 (48%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 ++S +E +PD LLP+T+GP++V+ +RWF G + SR ++RWI Sbjct: 140 LVSSVELIPDALLPVTRGPINVHLDRWFHGGNDSRRNKRWI 180 >ref|XP_004253072.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like [Solanum lycopersicum] Length = 117 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/41 (48%), Positives = 33/41 (80%) Frame = -3 Query: 257 MISEIESVPDPLLPMTKGPVDVNWERWFGGASSSRSHRRWI 135 ++S +E +PD LLP+T+GP++V+ +RWF G + SR ++RWI Sbjct: 77 LVSSVELIPDALLPVTRGPINVHLDRWFHGVNDSRRNKRWI 117