BLASTX nr result
ID: Achyranthes22_contig00038584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00038584 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22241.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] 74 2e-11 gb|ESW18500.1| hypothetical protein PHAVU_006G046500g [Phaseolus... 73 3e-11 gb|ESW18499.1| hypothetical protein PHAVU_006G046500g [Phaseolus... 73 3e-11 ref|XP_004306132.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 gb|EMJ18561.1| hypothetical protein PRUPE_ppa021574mg [Prunus pe... 72 6e-11 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006602255.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containi... 69 8e-10 ref|XP_004500100.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004233926.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002871658.1| pentatricopeptide repeat-containing protein ... 63 4e-08 ref|XP_002323869.2| pentatricopeptide repeat-containing family p... 62 6e-08 ref|XP_006400048.1| hypothetical protein EUTSA_v10012473mg [Eutr... 62 8e-08 ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, part... 62 1e-07 ref|NP_197032.1| pentatricopeptide repeat-containing protein [Ar... 60 2e-07 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 60 3e-07 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/85 (48%), Positives = 55/85 (64%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+P S+++L MI K LRPS+RNLRA I LC G L AL L ++ELRGWI Sbjct: 984 DVPTSVQYLTAMISKELRPSSRNLRAVISCLCDSGMLRKALELSREMELRGWIHGSIAQN 1043 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI+ L ++G + +AE+FL R +EK Sbjct: 1044 AIVGCLLSHGKLKEAESFLDRMVEK 1068 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/85 (48%), Positives = 55/85 (64%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+P S+++L MI K LRPS+RNLRA I LC G L AL L ++ELRGWI Sbjct: 1001 DVPTSVQYLTAMISKELRPSSRNLRAVISCLCDSGMLRKALELSREMELRGWIHGSIAQN 1060 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI+ L ++G + +AE+FL R +EK Sbjct: 1061 AIVGCLLSHGKLKEAESFLDRMVEK 1085 >gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] Length = 1087 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/85 (44%), Positives = 53/85 (62%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ ++ +L+ MI K LRPSNR+LR AI LC +L AL L ++E RGW+ + Sbjct: 813 DVSSALHYLSTMISKELRPSNRSLRVAITTLCNSSELVKALELSREMEQRGWVHDSAIQS 872 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 I+EGL + G + +AENFL R EK Sbjct: 873 MIVEGLLSRGKLQEAENFLDRLAEK 897 >gb|ESW18500.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 1189 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/85 (44%), Positives = 53/85 (62%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ +L MI KG +PSN NLR AI+ LC G L+ AL L ++ LRGWI + Sbjct: 920 DLSSSMNYLAIMISKGFKPSNHNLRKAIRSLCDAGDLQKALKLSQEMRLRGWIHDSAIQT 979 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 +I+E L +G I++AE FL R E+ Sbjct: 980 SIVESLLLSGKIHEAETFLDRMGEE 1004 >gb|ESW18499.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 859 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/85 (44%), Positives = 53/85 (62%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ +L MI KG +PSN NLR AI+ LC G L+ AL L ++ LRGWI + Sbjct: 590 DLSSSMNYLAIMISKGFKPSNHNLRKAIRSLCDAGDLQKALKLSQEMRLRGWIHDSAIQT 649 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 +I+E L +G I++AE FL R E+ Sbjct: 650 SIVESLLLSGKIHEAETFLDRMGEE 674 >ref|XP_004306132.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Fragaria vesca subsp. vesca] Length = 1246 Score = 72.8 bits (177), Expect = 4e-11 Identities = 39/77 (50%), Positives = 50/77 (64%) Frame = -1 Query: 231 LNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLYAILEGLFT 52 L MI K RPSNRNLR I LC G++E A L ++ELRGWI + AI+EGL + Sbjct: 978 LYTMISKDFRPSNRNLRKVIIGLCDMGEIEKASELSRQMELRGWIHDSIIQNAIVEGLLS 1037 Query: 51 NGNIYQAENFLARTMEK 1 +G + +AENFL R +EK Sbjct: 1038 HGRVQEAENFLDRMVEK 1054 >gb|EMJ18561.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] Length = 994 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/85 (43%), Positives = 54/85 (63%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ +++ L+ MI K RPSNRNLR + LC G+LE AL L ++E RGW+ + Sbjct: 718 DVSSAVEILSTMISKEFRPSNRNLRIVMTSLCGIGELEKALELSREMESRGWVHDSIIQN 777 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI+E L ++G + +AE FL R +EK Sbjct: 778 AIVEDLLSHGKLQEAEKFLDRMVEK 802 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/85 (44%), Positives = 51/85 (60%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ +L MI KGL+PSNR+LR I LC G L+ AL L ++ LRGW+ + Sbjct: 917 DLSSSLHYLTTMISKGLKPSNRSLRKVISKLCDAGNLKKALKLSQEMRLRGWMHDSSIQT 976 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 +I+E L GNI AE FL R E+ Sbjct: 977 SIVESLLLCGNIQGAETFLDRMGEE 1001 >ref|XP_006602255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 401 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/85 (44%), Positives = 50/85 (58%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ +L MI KGL+PSNR LR I LC G L+ AL L ++ LRGW+ + Sbjct: 132 DLSSSLHYLTTMISKGLKPSNRGLRKVISKLCDAGNLKKALELSQEMRLRGWMHDSSIQT 191 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 +I+E L GNI AE FL R E+ Sbjct: 192 SIVESLLLCGNIQGAETFLDRMGEE 216 >ref|XP_004163793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1225 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/84 (45%), Positives = 51/84 (60%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S +L MI G RPSNR+L A I +LC GQLE AL L ++E +GW+ + Sbjct: 952 DLSSSKLYLFTMIQLGFRPSNRSLNAVISHLCDIGQLEKALELSQEMESKGWVHSSAVQD 1011 Query: 75 AILEGLFTNGNIYQAENFLARTME 4 AI E L +NG + +AE FL R +E Sbjct: 1012 AIAECLISNGKLQEAECFLNRMVE 1035 >ref|XP_004139757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cucumis sativus] Length = 1246 Score = 68.6 bits (166), Expect = 8e-10 Identities = 38/84 (45%), Positives = 50/84 (59%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D S +L MI G RPSNR+L A I +LC GQLE AL L ++E +GW+ + Sbjct: 973 DFSSSKLYLFTMIQLGFRPSNRSLNAVISHLCDIGQLEKALELSQEMESKGWVHSSAVQD 1032 Query: 75 AILEGLFTNGNIYQAENFLARTME 4 AI E L +NG + +AE FL R +E Sbjct: 1033 AIAECLISNGKLQEAECFLNRMVE 1056 >ref|XP_004500100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Cicer arietinum] Length = 1191 Score = 67.0 bits (162), Expect = 2e-09 Identities = 36/81 (44%), Positives = 50/81 (61%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S +L MI KGL+PSNR+LR I LC G+L+ AL L ++ LRGWI + Sbjct: 919 DLSSSFHYLTTMISKGLKPSNRSLRMVISSLCDVGELQKALELSREMGLRGWIHDSIVQT 978 Query: 75 AILEGLFTNGNIYQAENFLAR 13 I+E L + G + +AE+FL R Sbjct: 979 TIVENLLSCGLVKEAESFLDR 999 >ref|XP_004233926.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Solanum lycopersicum] Length = 1237 Score = 65.5 bits (158), Expect = 7e-09 Identities = 36/85 (42%), Positives = 52/85 (61%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ + ++L M+ K LRPS+R+LR I+ LC YG+LE AL L ++E RGW + Sbjct: 967 DLSSATQYLKYMMEKDLRPSDRSLREVIKCLCCYGELEEALTLSKEMEFRGWNHGSVVQN 1026 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 I+E L +NG + +A NFL R K Sbjct: 1027 NIVETLLSNGKLGEAINFLDRMAMK 1051 >ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Citrus sinensis] Length = 1259 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/85 (37%), Positives = 53/85 (62%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ +++ M+ KG PSNR+LR+ I LC G+L AL L ++ L+G + + Sbjct: 995 DVSSSMYYISAMVSKGFNPSNRSLRSVISCLCEVGELGKALELSQEMRLKGLVHDSIVQN 1054 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI EGL + G + +AE+FL + ++K Sbjct: 1055 AIAEGLLSRGKLQEAEHFLDQIVDK 1079 >ref|XP_002871658.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317495|gb|EFH47917.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1223 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D S+++L+ MI KG++P+NR+LRA LC G ++ AL L +E +GWIL + Sbjct: 955 DYSSSLRYLSAMISKGMKPNNRSLRAVTSSLCDNGDVKKALDLWQVMESKGWILGSSVAQ 1014 Query: 75 A-ILEGLFTNGNIYQAENFLAR 13 I+E L + G I +AE+FL R Sbjct: 1015 TKIVESLISKGEIPKAEDFLTR 1036 >ref|XP_002323869.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320105|gb|EEF04002.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1255 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/85 (40%), Positives = 49/85 (57%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ + +L+ MI K LRPS R+L I +LC G+L+ L L ++EL+GWIL Sbjct: 979 DVSTVMHYLSTMISKELRPSYRSLSTVITFLCDIGELDKVLELSREIELKGWILGSIAQN 1038 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI+EGL + A+ FL R + K Sbjct: 1039 AIVEGLLFQDKVEAAKQFLDRMVYK 1063 >ref|XP_006400048.1| hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] gi|557101138|gb|ESQ41501.1| hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] Length = 1222 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = -1 Query: 267 SVWNDMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHP 88 S+ D S+++L+ MI +G++PSNR+LR I LC G ++ AL L +E +GW+ Sbjct: 951 SLCGDDSSSLQYLSAMISEGMKPSNRSLRVVISSLCDNGDVKKALNLWQVMESKGWVFGS 1010 Query: 87 GLLYA-ILEGLFTNGNIYQAENFLAR 13 ++ I E L + G I +AE+FL R Sbjct: 1011 SVVQTKIAESLISRGEILKAEDFLIR 1036 >ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] gi|557533255|gb|ESR44438.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] Length = 1231 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/85 (36%), Positives = 52/85 (61%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ S+ ++ M+ KG PSNR+LR+ I LC G+L +L L ++ L+G + + Sbjct: 964 DVSSSMYYIAAMVSKGFNPSNRSLRSVISCLCEVGELGKSLELSQEMRLKGLVHDSIVQN 1023 Query: 75 AILEGLFTNGNIYQAENFLARTMEK 1 AI EGL + G + +AE+FL + ++K Sbjct: 1024 AIAEGLLSRGKLQEAEHFLDQIVDK 1048 >ref|NP_197032.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180846|sp|Q9LXF4.1|PP384_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15280 gi|7671497|emb|CAB89338.1| putative protein [Arabidopsis thaliana] gi|332004760|gb|AED92143.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 1227 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D S+++L+ MI KG++P+NR+LRA LC G ++ AL L +E +GW L ++ Sbjct: 959 DYSSSLRYLSAMISKGMKPNNRSLRAVTSSLCDNGDVKKALDLWQVMESKGWNLGSSVVQ 1018 Query: 75 A-ILEGLFTNGNIYQAENFLAR 13 I+E L + G I +AE+FL R Sbjct: 1019 TKIVETLISKGEIPKAEDFLTR 1040 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/81 (35%), Positives = 48/81 (59%) Frame = -1 Query: 255 DMPRSIKFLNDMIIKGLRPSNRNLRAAIQYLCRYGQLENALLLINKVELRGWILHPGLLY 76 D+ + +++ MI KG +P+NR++R A+ +C GQL L L ++E RGWI + Sbjct: 922 DVASVVHYMSTMISKGFKPNNRSIRTAVTCMCDLGQLSEVLELSQEMEKRGWIHGSFVQN 981 Query: 75 AILEGLFTNGNIYQAENFLAR 13 AI+E ++ + +AE FL R Sbjct: 982 AIVESFLSHDKLQEAEYFLDR 1002