BLASTX nr result
ID: Achyranthes22_contig00036895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036895 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497255.1| PREDICTED: uncharacterized ATP-dependent hel... 57 3e-06 ref|XP_006306192.1| hypothetical protein CARUB_v10011822mg [Caps... 55 7e-06 ref|XP_006296862.1| hypothetical protein CARUB_v10012850mg [Caps... 55 7e-06 gb|AAF87890.1|AC012561_23 Similar tp transcription factors [Arab... 55 7e-06 ref|NP_564568.1| SNF2 and helicase domain-containing protein [Ar... 55 7e-06 ref|XP_006589745.1| PREDICTED: uncharacterized ATP-dependent hel... 55 1e-05 gb|ESW14733.1| hypothetical protein PHAVU_007G012900g [Phaseolus... 55 1e-05 >ref|XP_004497255.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like [Cicer arietinum] Length = 1072 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHVGCN-VRLTIDDLKYIFL 124 ALQEEKRKMVASAFGE+H G + RLT+DDLKY+F+ Sbjct: 1036 ALQEEKRKMVASAFGEDHAGSSGTRLTVDDLKYLFM 1071 >ref|XP_006306192.1| hypothetical protein CARUB_v10011822mg [Capsella rubella] gi|482574903|gb|EOA39090.1| hypothetical protein CARUB_v10011822mg [Capsella rubella] Length = 997 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHVGCN-VRLTIDDLKYIFL 124 ALQEEKRKMVASAFGE+H G + RLT+DDLKY+F+ Sbjct: 961 ALQEEKRKMVASAFGEDHGGSSATRLTVDDLKYLFM 996 >ref|XP_006296862.1| hypothetical protein CARUB_v10012850mg [Capsella rubella] gi|482565571|gb|EOA29760.1| hypothetical protein CARUB_v10012850mg [Capsella rubella] Length = 1138 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHVGCNV-RLTIDDLKYIFL 124 ALQEEKRKMVASAFGE+H G + RLT+DDLKY+F+ Sbjct: 1102 ALQEEKRKMVASAFGEDHGGSSAKRLTVDDLKYLFM 1137 >gb|AAF87890.1|AC012561_23 Similar tp transcription factors [Arabidopsis thaliana] Length = 1062 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHVGCN-VRLTIDDLKYIFL 124 ALQEEKRKMVASAFGE+H G + RLT+DDLKY+F+ Sbjct: 1026 ALQEEKRKMVASAFGEDHGGSSATRLTVDDLKYLFM 1061 >ref|NP_564568.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|14532630|gb|AAK64043.1| putative DNA-binding protein [Arabidopsis thaliana] gi|23296945|gb|AAN13207.1| putative DNA-binding protein [Arabidopsis thaliana] gi|332194424|gb|AEE32545.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Length = 981 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHVGCN-VRLTIDDLKYIFL 124 ALQEEKRKMVASAFGE+H G + RLT+DDLKY+F+ Sbjct: 945 ALQEEKRKMVASAFGEDHGGSSATRLTVDDLKYLFM 980 >ref|XP_006589745.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like [Glycine max] Length = 1024 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHV-GCNVRLTIDDLKYIFL 124 ALQE+KRKMVASAFGE+H G RLT+DDLKY+F+ Sbjct: 988 ALQEDKRKMVASAFGEDHAGGTGTRLTVDDLKYLFM 1023 >gb|ESW14733.1| hypothetical protein PHAVU_007G012900g [Phaseolus vulgaris] Length = 1011 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 228 ALQEEKRKMVASAFGEEHV-GCNVRLTIDDLKYIFL 124 ALQ+EKRKMVASAFGE+H G RLT+DDLKY+F+ Sbjct: 975 ALQDEKRKMVASAFGEDHAGGSGARLTVDDLKYLFM 1010