BLASTX nr result
ID: Achyranthes22_contig00036843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036843 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59765.1| cp protein [Celosia cristata] 60 2e-07 >emb|CAD59765.1| cp protein [Celosia cristata] Length = 170 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 150 MDGMFGSFGSYWLGQKATKEFSSAGDDINSLGSSVG 257 MD +F GSYWLGQKA KEF+S GDDINS+GSS+G Sbjct: 1 MDQIFNKVGSYWLGQKANKEFNSVGDDINSMGSSIG 36