BLASTX nr result
ID: Achyranthes22_contig00036674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036674 (592 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006577661.1| PREDICTED: PXMP2/4 family protein 4-like [Gl... 56 8e-06 >ref|XP_006577661.1| PREDICTED: PXMP2/4 family protein 4-like [Glycine max] Length = 179 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 491 LLIQLVTDKVPSLHYRRTFMFTFLGLALLGPTLH 592 LL +LV DKVPSL ++RTF+FTFLG AL+GPTLH Sbjct: 36 LLCELVIDKVPSLDFKRTFVFTFLGFALVGPTLH 69