BLASTX nr result
ID: Achyranthes22_contig00036660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036660 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004244895.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 >ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum tuberosum] Length = 440 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 1 TYKLVLDALRCSGRADLLDEATCKRIEDGMVVRYRQRMKAKPIM 132 TYKLV DAL SG+ DLLDE C R+EDG+ R RQ MK KP++ Sbjct: 391 TYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLL 434 >ref|XP_004244895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum lycopersicum] Length = 426 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 1 TYKLVLDALRCSGRADLLDEATCKRIEDGMVVRYRQRMKAKPIM 132 TYKLV DAL SG+ DLLDE C R+EDG+ R RQ MK KP++ Sbjct: 375 TYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLL 418