BLASTX nr result
ID: Achyranthes22_contig00036600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036600 (249 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006487327.1| PREDICTED: kinesin-related protein 11-like i... 68 1e-09 ref|XP_006487326.1| PREDICTED: kinesin-related protein 11-like i... 68 1e-09 ref|XP_006487325.1| PREDICTED: kinesin-related protein 11-like i... 68 1e-09 ref|XP_006423432.1| hypothetical protein CICLE_v10027716mg [Citr... 68 1e-09 ref|XP_004292421.1| PREDICTED: uncharacterized protein LOC101301... 68 1e-09 gb|EMJ00889.1| hypothetical protein PRUPE_ppa000583mg [Prunus pe... 68 1e-09 gb|EXC24663.1| hypothetical protein L484_008434 [Morus notabilis] 67 2e-09 ref|XP_006577909.1| PREDICTED: kinesin-related protein 11-like [... 67 2e-09 ref|XP_006352080.1| PREDICTED: kinesin-related protein 11-like [... 67 2e-09 gb|ESW07926.1| hypothetical protein PHAVU_009G004100g [Phaseolus... 67 2e-09 gb|ESW03770.1| hypothetical protein PHAVU_011G040700g [Phaseolus... 67 2e-09 gb|ESW03769.1| hypothetical protein PHAVU_011G040700g [Phaseolus... 67 2e-09 gb|ESW03768.1| hypothetical protein PHAVU_011G040700g [Phaseolus... 67 2e-09 ref|XP_002313019.2| hypothetical protein POPTR_0009s12510g [Popu... 67 2e-09 gb|EOX97894.1| Kinesin motor family protein isoform 3 [Theobroma... 67 2e-09 gb|EOX97893.1| Kinesin motor family protein isoform 2 [Theobroma... 67 2e-09 gb|EOX97892.1| Kinesin motor family protein isoform 1 [Theobroma... 67 2e-09 ref|XP_004507492.1| PREDICTED: kinesin-related protein 4-like is... 67 2e-09 ref|XP_004507491.1| PREDICTED: kinesin-related protein 4-like is... 67 2e-09 ref|XP_004500779.1| PREDICTED: kinesin-related protein 11-like i... 67 2e-09 >ref|XP_006487327.1| PREDICTED: kinesin-related protein 11-like isoform X3 [Citrus sinensis] Length = 1075 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 397 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 432 >ref|XP_006487326.1| PREDICTED: kinesin-related protein 11-like isoform X2 [Citrus sinensis] Length = 1101 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 397 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 432 >ref|XP_006487325.1| PREDICTED: kinesin-related protein 11-like isoform X1 [Citrus sinensis] Length = 1102 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 397 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 432 >ref|XP_006423432.1| hypothetical protein CICLE_v10027716mg [Citrus clementina] gi|557525366|gb|ESR36672.1| hypothetical protein CICLE_v10027716mg [Citrus clementina] Length = 1108 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 397 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 432 >ref|XP_004292421.1| PREDICTED: uncharacterized protein LOC101301753, partial [Fragaria vesca subsp. vesca] Length = 1080 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 398 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 433 >gb|EMJ00889.1| hypothetical protein PRUPE_ppa000583mg [Prunus persica] Length = 1087 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SSSMEETHNTLKFASRAK VEI+ASRNK Sbjct: 393 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 428 >gb|EXC24663.1| hypothetical protein L484_008434 [Morus notabilis] Length = 1174 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 395 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 430 >ref|XP_006577909.1| PREDICTED: kinesin-related protein 11-like [Glycine max] Length = 1070 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 390 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 425 >ref|XP_006352080.1| PREDICTED: kinesin-related protein 11-like [Solanum tuberosum] Length = 1069 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 393 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 428 >gb|ESW07926.1| hypothetical protein PHAVU_009G004100g [Phaseolus vulgaris] gi|561009020|gb|ESW07927.1| hypothetical protein PHAVU_009G004100g [Phaseolus vulgaris] Length = 1080 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 389 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 424 >gb|ESW03770.1| hypothetical protein PHAVU_011G040700g [Phaseolus vulgaris] Length = 1071 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 390 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 425 >gb|ESW03769.1| hypothetical protein PHAVU_011G040700g [Phaseolus vulgaris] Length = 976 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 354 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 389 >gb|ESW03768.1| hypothetical protein PHAVU_011G040700g [Phaseolus vulgaris] Length = 1035 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 354 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 389 >ref|XP_002313019.2| hypothetical protein POPTR_0009s12510g [Populus trichocarpa] gi|550331592|gb|EEE86974.2| hypothetical protein POPTR_0009s12510g [Populus trichocarpa] Length = 1064 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 388 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 423 >gb|EOX97894.1| Kinesin motor family protein isoform 3 [Theobroma cacao] Length = 774 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 73 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 108 >gb|EOX97893.1| Kinesin motor family protein isoform 2 [Theobroma cacao] Length = 1030 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 394 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 429 >gb|EOX97892.1| Kinesin motor family protein isoform 1 [Theobroma cacao] Length = 1033 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 394 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 429 >ref|XP_004507492.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum] Length = 1080 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 388 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 423 >ref|XP_004507491.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum] Length = 1081 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 388 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 423 >ref|XP_004500779.1| PREDICTED: kinesin-related protein 11-like isoform X2 [Cicer arietinum] Length = 1061 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 249 LICTVTPESSSMEETHNTLKFASRAKNVEIFASRNK 142 LICTVTP SS+MEETHNTLKFASRAK VEI+ASRNK Sbjct: 389 LICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 424