BLASTX nr result
ID: Achyranthes22_contig00036403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036403 (503 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13851.1| hypothetical protein [Beta vulgaris subsp. vulgaris] 87 2e-15 >gb|AFK13851.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 65 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/60 (63%), Positives = 50/60 (83%) Frame = -3 Query: 387 MTDNGAALQTLPPKRGQIKAKIAGKLVDLVKTEAPEPSVNYCPRSLSSSDPNPDRCIIGH 208 M++NGA +QTLPP+RG +KA I GKLV+LVKTE P P+++YCPRS++ S+ N DRCII H Sbjct: 6 MSENGAGVQTLPPRRGLVKAMIVGKLVELVKTEHPAPTMSYCPRSVNKSEANSDRCIITH 65