BLASTX nr result
ID: Achyranthes22_contig00036188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036188 (296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231997.1| PREDICTED: uncharacterized protein At1g66480... 66 4e-09 gb|EOY04003.1| Plastid movement impaired 2 [Theobroma cacao] 65 9e-09 ref|XP_006372587.1| hypothetical protein POPTR_0017s03000g [Popu... 64 2e-08 ref|XP_002301695.1| predicted protein [Populus trichocarpa] gi|5... 64 2e-08 ref|XP_004490863.1| PREDICTED: uncharacterized protein At1g66480... 64 2e-08 ref|XP_002888813.1| hypothetical protein ARALYDRAFT_894932 [Arab... 63 4e-08 ref|XP_003544245.1| PREDICTED: uncharacterized protein At1g66480... 62 6e-08 gb|EXC20656.1| hypothetical protein L484_027215 [Morus notabilis] 62 8e-08 ref|XP_006357781.1| PREDICTED: uncharacterized protein At1g66480... 62 8e-08 gb|EMJ17641.1| hypothetical protein PRUPE_ppa021996mg, partial [... 62 8e-08 ref|XP_002278115.1| PREDICTED: uncharacterized protein At1g66480... 62 8e-08 ref|XP_006390815.1| hypothetical protein EUTSA_v10019172mg [Eutr... 62 1e-07 ref|XP_003519341.1| PREDICTED: uncharacterized protein At1g66480... 62 1e-07 ref|XP_003616384.1| hypothetical protein MTR_5g079610 [Medicago ... 62 1e-07 gb|EOY00937.1| Encodes a protein whose expression is responsive ... 61 2e-07 ref|XP_003537453.1| PREDICTED: uncharacterized protein At1g66480... 61 2e-07 ref|XP_006482147.1| PREDICTED: uncharacterized protein At1g66480... 60 2e-07 ref|XP_006430644.1| hypothetical protein CICLE_v10012690mg [Citr... 60 2e-07 ref|XP_004503145.1| PREDICTED: uncharacterized protein At1g66480... 60 2e-07 ref|XP_004140307.1| PREDICTED: uncharacterized protein At1g66480... 60 2e-07 >ref|XP_004231997.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum] Length = 166 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -1 Query: 152 KIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 K+MKING+ KLK P+ + V KDYP H+LL+SE +F +RAKPL PE Sbjct: 13 KVMKINGEILKLKTPITTLEVVKDYPGHVLLESEAVKKFGIRAKPLEPE 61 >gb|EOY04003.1| Plastid movement impaired 2 [Theobroma cacao] Length = 219 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AK+MKI+G+ FKLK P+ +V KDYP H+LLDSE F +RAKPL P+ Sbjct: 11 AKVMKIDGETFKLKTPVRAWDVVKDYPGHVLLDSEAVKHFGIRAKPLEPQ 60 >ref|XP_006372587.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa] gi|550319216|gb|ERP50384.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa] Length = 201 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AK+MKING+ FKLK P +V KDYP ++LLDSE F +RAKPL P+ Sbjct: 11 AKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ 60 >ref|XP_002301695.1| predicted protein [Populus trichocarpa] gi|566211029|ref|XP_006372588.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa] gi|550319217|gb|ERP50385.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa] Length = 216 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AK+MKING+ FKLK P +V KDYP ++LLDSE F +RAKPL P+ Sbjct: 11 AKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQ 60 >ref|XP_004490863.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum] Length = 210 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AK+MKI+G+ FK+K+P +V KDYPNH+LLDS+ F LRA+PL P Sbjct: 11 AKVMKIDGETFKVKIPSTANDVVKDYPNHVLLDSQAVKHFGLRARPLEP 59 >ref|XP_002888813.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. lyrata] gi|297334654|gb|EFH65072.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. lyrata] Length = 197 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AKIM ING+ FKLK P+ V KD+P HILL+SE RF +RAKPL P Sbjct: 11 AKIMNINGESFKLKTPVKAGTVVKDFPGHILLESEAVKRFGIRAKPLEP 59 >ref|XP_003544245.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max] Length = 214 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = -1 Query: 152 KIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 K+MK++G+ FKLK P +V KDYP H+LLDSE F LRAKPL P Sbjct: 12 KVMKVDGETFKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEP 59 >gb|EXC20656.1| hypothetical protein L484_027215 [Morus notabilis] Length = 230 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -1 Query: 152 KIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 KIMKING+ FK+K+P+ ++VTKD+ H+LLDSE F ++A PL P+ Sbjct: 14 KIMKINGETFKVKIPIRALDVTKDHQGHVLLDSEAVKHFGIKANPLEPQ 62 >ref|XP_006357781.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum] Length = 162 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -1 Query: 158 AAKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 + K+MKING+ KLK P+ V KDYP H+LL+SE +F +RAKPL E Sbjct: 8 STKVMKINGEILKLKTPITTSEVVKDYPGHVLLESEAVKKFGIRAKPLEAE 58 >gb|EMJ17641.1| hypothetical protein PRUPE_ppa021996mg, partial [Prunus persica] Length = 166 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AK+MKI+G+ FK+K P+ +V KDYP H+LL+SE F +RAKPL P+ Sbjct: 11 AKVMKISGETFKVKTPIRARDVVKDYPGHVLLNSEAVKHFGVRAKPLEPQ 60 >ref|XP_002278115.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera] gi|297734300|emb|CBI15547.3| unnamed protein product [Vitis vinifera] Length = 204 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AK+MKI+ FKLK P+ V KDYP H+L++SE F F +RAKPL P+ Sbjct: 11 AKVMKIDSQTFKLKTPVRVWETVKDYPGHVLIESEAFKHFGIRAKPLEPQ 60 >ref|XP_006390815.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum] gi|557087249|gb|ESQ28101.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum] Length = 196 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AKIMKI+G+ FKLK P+ V KDYP H+L +SE F +RAKPL P Sbjct: 11 AKIMKIDGESFKLKTPVKAGTVVKDYPGHVLFESESVKHFGIRAKPLDP 59 >ref|XP_003519341.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max] Length = 214 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AK+MK++G+ KLK P +V KDYP H+LLDSE F LRAKPL P Sbjct: 11 AKVMKVDGETLKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEP 59 >ref|XP_003616384.1| hypothetical protein MTR_5g079610 [Medicago truncatula] gi|355517719|gb|AES99342.1| hypothetical protein MTR_5g079610 [Medicago truncatula] Length = 211 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AKIMKI+G+ FK+K P V K+YPNH+LLDS+ F LRAKPL P Sbjct: 11 AKIMKIDGETFKVKTPTTSNEVVKNYPNHVLLDSQAVKHFGLRAKPLEP 59 >gb|EOY00937.1| Encodes a protein whose expression is responsive to nematode infection, putative [Theobroma cacao] Length = 227 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -1 Query: 152 KIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPL 15 K+MKING+ FKLK P+ V KDYP H+LL+SE F +RAKPL Sbjct: 12 KVMKINGETFKLKTPVKAEEVVKDYPGHVLLESESVKHFGIRAKPL 57 >ref|XP_003537453.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max] Length = 214 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 AKIMKI+G+ FKLK P +V KDYP H+LLDS F RAKPL P+ Sbjct: 10 AKIMKIDGETFKLKTPARANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPD 59 >ref|XP_006482147.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis] Length = 225 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AK+MKI+G+ KLK P+ V KDYP ++LLDSE F +RAKPL P Sbjct: 11 AKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEP 59 >ref|XP_006430644.1| hypothetical protein CICLE_v10012690mg [Citrus clementina] gi|557532701|gb|ESR43884.1| hypothetical protein CICLE_v10012690mg [Citrus clementina] Length = 223 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AK+MKI+G+ KLK P+ V KDYP ++LLDSE F +RAKPL P Sbjct: 11 AKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEP 59 >ref|XP_004503145.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum] Length = 217 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 155 AKIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSP 9 AK+MK++G+ FKLK+P +V KDYP H LL+S+ F LRAKPL P Sbjct: 12 AKVMKLDGETFKLKIPARANDVVKDYPGHALLESQAVKHFGLRAKPLEP 60 >ref|XP_004140307.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis sativus] gi|449506058|ref|XP_004162640.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis sativus] Length = 237 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = -1 Query: 152 KIMKINGDFFKLKLPLMVINVTKDYPNHILLDSEDFLRFNLRAKPLSPE 6 K+MK++G+ KLKLP+ V V KDYP+H+L++SE + ++AKPL P+ Sbjct: 12 KVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQ 60