BLASTX nr result
ID: Achyranthes22_contig00036050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00036050 (213 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63458.1| hypothetical protein M569_11326, partial [Genlise... 76 4e-12 gb|EOY11627.1| Uncharacterized protein TCM_026746 [Theobroma cacao] 75 1e-11 gb|EPS60492.1| hypothetical protein M569_14311, partial [Genlise... 74 2e-11 gb|EXC73757.1| hypothetical protein L484_000277 [Morus notabilis] 74 3e-11 gb|EXB95702.1| hypothetical protein L484_007452 [Morus notabilis] 74 3e-11 gb|EMJ08799.1| hypothetical protein PRUPE_ppa019171mg [Prunus pe... 74 3e-11 ref|XP_003535325.2| PREDICTED: uncharacterized protein DDB_G0271... 73 3e-11 gb|ESW16985.1| hypothetical protein PHAVU_007G200400g [Phaseolus... 73 3e-11 ref|XP_003556537.1| PREDICTED: uncharacterized protein LOC100798... 73 3e-11 ref|XP_002319488.2| hypothetical protein POPTR_0013s01170g [Popu... 72 6e-11 emb|CBI36924.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002275068.1| PREDICTED: uncharacterized protein LOC100262... 72 6e-11 emb|CAN74687.1| hypothetical protein VITISV_020417 [Vitis vinifera] 72 6e-11 ref|XP_006344745.1| PREDICTED: suppressor protein SRP40-like [So... 72 8e-11 gb|ESW35324.1| hypothetical protein PHAVU_001G225700g [Phaseolus... 72 8e-11 ref|XP_004495671.1| PREDICTED: uncharacterized protein DDB_G0271... 72 8e-11 ref|XP_004230290.1| PREDICTED: uncharacterized protein LOC101243... 72 8e-11 ref|XP_003553707.1| PREDICTED: uncharacterized protein LOC100797... 72 8e-11 ref|XP_003520793.1| PREDICTED: uncharacterized protein LOC100815... 72 8e-11 ref|XP_003591203.1| Pheromone receptor-like protein [Medicago tr... 72 8e-11 >gb|EPS63458.1| hypothetical protein M569_11326, partial [Genlisea aurea] Length = 225 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 SAHELHY ANRAQAEEMRKKTFLPYRQGLL CLGFNS Sbjct: 170 SAHELHYTANRAQAEEMRKKTFLPYRQGLLACLGFNS 206 >gb|EOY11627.1| Uncharacterized protein TCM_026746 [Theobroma cacao] Length = 389 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEMRKKTFLPYRQGLLGCLGF+S Sbjct: 334 SPHELHYTANRAQAEEMRKKTFLPYRQGLLGCLGFSS 370 >gb|EPS60492.1| hypothetical protein M569_14311, partial [Genlisea aurea] Length = 319 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 SAHELHY ANRAQAEEMRKKTFLPYRQGLL CLGF+S Sbjct: 264 SAHELHYTANRAQAEEMRKKTFLPYRQGLLACLGFSS 300 >gb|EXC73757.1| hypothetical protein L484_000277 [Morus notabilis] Length = 402 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEM+KKTFLPYRQGLLGCLGF+S Sbjct: 347 SPHELHYTANRAQAEEMKKKTFLPYRQGLLGCLGFSS 383 >gb|EXB95702.1| hypothetical protein L484_007452 [Morus notabilis] Length = 509 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEM+KKTFLPYRQGLLGCLGF+S Sbjct: 347 SPHELHYTANRAQAEEMKKKTFLPYRQGLLGCLGFSS 383 >gb|EMJ08799.1| hypothetical protein PRUPE_ppa019171mg [Prunus persica] Length = 419 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEMRKKT+LPYRQGLLGCLGF+S Sbjct: 362 SLHELHYTANRAQAEEMRKKTYLPYRQGLLGCLGFSS 398 >ref|XP_003535325.2| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine max] Length = 396 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+RKKTFLPYRQGLLGCLGF+S Sbjct: 330 SPHELHYKANRAQAEELRKKTFLPYRQGLLGCLGFSS 366 >gb|ESW16985.1| hypothetical protein PHAVU_007G200400g [Phaseolus vulgaris] Length = 454 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+RKKTFLPYRQGLLGCLGF+S Sbjct: 343 SPHELHYKANRAQAEELRKKTFLPYRQGLLGCLGFSS 379 >ref|XP_003556537.1| PREDICTED: uncharacterized protein LOC100798350 [Glycine max] Length = 378 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+RKKTFLPYRQGLLGCLGF+S Sbjct: 323 SPHELHYKANRAQAEELRKKTFLPYRQGLLGCLGFSS 359 >ref|XP_002319488.2| hypothetical protein POPTR_0013s01170g [Populus trichocarpa] gi|550324666|gb|EEE95411.2| hypothetical protein POPTR_0013s01170g [Populus trichocarpa] Length = 423 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY A+RAQAEEMRKKTFLPYRQGLLGCLGF+S Sbjct: 368 SPHELHYKASRAQAEEMRKKTFLPYRQGLLGCLGFSS 404 >emb|CBI36924.3| unnamed protein product [Vitis vinifera] Length = 250 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEM+K+TFLPYRQGLLGCLGF+S Sbjct: 185 SPHELHYTANRAQAEEMKKRTFLPYRQGLLGCLGFSS 221 >ref|XP_002275068.1| PREDICTED: uncharacterized protein LOC100262334 [Vitis vinifera] Length = 403 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEM+K+TFLPYRQGLLGCLGF+S Sbjct: 348 SPHELHYTANRAQAEEMKKRTFLPYRQGLLGCLGFSS 384 >emb|CAN74687.1| hypothetical protein VITISV_020417 [Vitis vinifera] Length = 444 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEEM+K+TFLPYRQGLLGCLGF+S Sbjct: 348 SPHELHYTANRAQAEEMKKRTFLPYRQGLLGCLGFSS 384 >ref|XP_006344745.1| PREDICTED: suppressor protein SRP40-like [Solanum tuberosum] Length = 382 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY NRAQ+EEMRKKTFLPYRQGLLGCLGF+S Sbjct: 327 SPHELHYTTNRAQSEEMRKKTFLPYRQGLLGCLGFSS 363 >gb|ESW35324.1| hypothetical protein PHAVU_001G225700g [Phaseolus vulgaris] Length = 331 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+R+KTFLPYRQGLLGCLGF+S Sbjct: 276 SPHELHYKANRAQAEELRRKTFLPYRQGLLGCLGFSS 312 >ref|XP_004495671.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Cicer arietinum] Length = 395 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+RKKTFLPY+QGLLGCLGF+S Sbjct: 340 SPHELHYKANRAQAEELRKKTFLPYKQGLLGCLGFSS 376 >ref|XP_004230290.1| PREDICTED: uncharacterized protein LOC101243829 [Solanum lycopersicum] Length = 398 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY NRAQ+EEMRKKTFLPYRQGLLGCLGF+S Sbjct: 343 SPHELHYTTNRAQSEEMRKKTFLPYRQGLLGCLGFSS 379 >ref|XP_003553707.1| PREDICTED: uncharacterized protein LOC100797967 [Glycine max] Length = 326 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+R+KTFLPYRQGLLGCLGF+S Sbjct: 271 SPHELHYKANRAQAEELRRKTFLPYRQGLLGCLGFSS 307 >ref|XP_003520793.1| PREDICTED: uncharacterized protein LOC100815893 [Glycine max] Length = 319 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+R+KTFLPYRQGLLGCLGF+S Sbjct: 264 SPHELHYKANRAQAEELRRKTFLPYRQGLLGCLGFSS 300 >ref|XP_003591203.1| Pheromone receptor-like protein [Medicago truncatula] gi|355480251|gb|AES61454.1| Pheromone receptor-like protein [Medicago truncatula] Length = 461 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 102 SAHELHYAANRAQAEEMRKKTFLPYRQGLLGCLGFNS 212 S HELHY ANRAQAEE+R+KTFLPYRQGLLGCLGF+S Sbjct: 345 SPHELHYKANRAQAEELRRKTFLPYRQGLLGCLGFSS 381