BLASTX nr result
ID: Achyranthes22_contig00034743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034743 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 94 2e-17 gb|AFK40073.1| unknown [Lotus japonicus] 92 7e-17 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 90 4e-16 emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 89 6e-16 ref|NP_001236539.1| uncharacterized protein LOC100305522 precurs... 88 1e-15 ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like pre... 88 1e-15 emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 87 2e-15 sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 87 3e-15 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 86 5e-15 emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 86 5e-15 emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|... 86 7e-15 emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] 86 7e-15 emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp... 86 7e-15 emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp... 86 7e-15 emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|6... 86 7e-15 ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|3... 85 9e-15 dbj|BAF50740.1| trypsin inhibitor [Apios americana] 85 1e-14 ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medic... 84 1e-14 emb|CAC24566.1| trypsin inhibitor [Pisum sativum] 84 2e-14 gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK... 84 3e-14 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 93.6 bits (231), Expect = 2e-17 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -3 Query: 291 ICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPCT 142 +CTRS+PPQCRC D+G TCH+ACK+C CT+S PPQCRC+DIT + Y PCT Sbjct: 12 LCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPCT 61 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 92.0 bits (227), Expect = 7e-17 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPCTCE 136 CTRS+PPQCRC D+G TCH+ACK C CT+S PPQCRC DIT + Y PCT E Sbjct: 65 CTRSIPPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNFCYDPCTPE 115 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 89.7 bits (221), Expect = 4e-16 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PPQCRC D+G TCH+ACK+C CT+S PPQCRCTDIT + Y C Sbjct: 65 CTRSIPPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 89.0 bits (219), Expect = 6e-16 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CT+S+PPQCRC D+G TCH+ACK+C CT+S PPQCRCTDIT + Y C Sbjct: 65 CTKSIPPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >ref|NP_001236539.1| uncharacterized protein LOC100305522 precursor [Glycine max] gi|255625791|gb|ACU13240.1| unknown [Glycine max] Length = 117 Score = 87.8 bits (216), Expect = 1e-15 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CT+S+PPQCRC D+G TCH+ACK C CT+S PPQC C+DIT + Y PC Sbjct: 62 CTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like precursor [Glycine max] gi|168259034|gb|ACA23206.1| putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 87.8 bits (216), Expect = 1e-15 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CT+S+PPQCRC D+G TCH+ACK C CT+S PPQC C+DIT + Y PC Sbjct: 62 CTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 87.4 bits (215), Expect = 2e-15 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+CRC D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCRCTDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 86.7 bits (213), Expect = 3e-15 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PPQCRC D+G TCH+ACK C CTKS PPQC C DIT + Y C Sbjct: 10 CTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 85.9 bits (211), Expect = 5e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKKC 103 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 85.9 bits (211), Expect = 5e-15 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 291 ICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 +CTRS+PP+CRC D+G TCH+ACK C CT+S PPQCRC DIT + Y C Sbjct: 55 LCTRSIPPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|66840748|emb|CAH04449.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] gi|66840754|emb|CAH04452.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|66840740|emb|CAH04445.1| putative trypsin inhibitor [Lens culinaris] gi|66840744|emb|CAH04447.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 85.5 bits (210), Expect = 7e-15 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 CTRS+PP+C C D+G TCH+ACK+C CT+S PPQCRCTD+T + Y C Sbjct: 56 CTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|355498962|gb|AES80165.1| Trypsin inhibitor [Medicago truncatula] gi|388499582|gb|AFK37857.1| unknown [Medicago truncatula] Length = 120 Score = 85.1 bits (209), Expect = 9e-15 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 288 CTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPCT 142 CT+S+PPQC C D+G CH+ACK C CT+S PPQCRCTD T + Y PC+ Sbjct: 64 CTKSIPPQCHCADIGEKCHSACKRCLCTRSFPPQCRCTDTTDFCYEPCS 112 >dbj|BAF50740.1| trypsin inhibitor [Apios americana] Length = 116 Score = 84.7 bits (208), Expect = 1e-14 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -3 Query: 300 DFEICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 D +CT+S+PPQCRC D+G TCH+ACK C CT+S PPQCRC D + Y PC Sbjct: 56 DLCLCTKSIPPQCRCADIGETCHSACKACLCTRSFPPQCRCADGNDFCYEPC 107 >ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] gi|355498950|gb|AES80153.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] Length = 242 Score = 84.3 bits (207), Expect = 1e-14 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = -3 Query: 300 DFEICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPCT 142 DF CTRS+PPQC+C DV CH+ACK+C CT+S PPQCRC DIT + Y CT Sbjct: 58 DFCPCTRSIPPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYPSCT 110 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 3/51 (5%) Frame = -3 Query: 288 CTRSLPP---QCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 C S+ P QCRC DVG TCH+ACKNC+C S+ P C C DIT + Y PC Sbjct: 192 CLCSVTPELTQCRCADVGKTCHSACKNCECGWSS-PLCTCYDITDFCYKPC 241 >emb|CAC24566.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 84.0 bits (206), Expect = 2e-14 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -3 Query: 291 ICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPC 145 +CTRS+PPQC+C D+G TCH+ACK C CT+S PP+C CTDIT + Y C Sbjct: 55 LCTRSIPPQCQCNDIGETCHSACKACLCTRSLPPKCSCTDITDFCYKKC 103 >gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK36454.1| unknown [Medicago truncatula] Length = 110 Score = 83.6 bits (205), Expect = 3e-14 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = -3 Query: 300 DFEICTRSLPPQCRCQDVGSTCHAACKNCKCTKSNPPQCRCTDITLYSYGPCT 142 DF CTRS+PPQC+C DV CH+ACK+C CT+S PPQCRC DIT + Y C+ Sbjct: 58 DFCPCTRSIPPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYSSCS 110