BLASTX nr result
ID: Achyranthes22_contig00034529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034529 (629 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300474.2| OTU-like cysteine protease family protein [P... 58 2e-06 ref|XP_006370448.1| hypothetical protein POPTR_0001s42650g [Popu... 58 2e-06 ref|XP_006370447.1| hypothetical protein POPTR_0001s42650g [Popu... 58 2e-06 gb|EOY12357.1| Cysteine-type peptidase, putative [Theobroma cacao] 56 7e-06 gb|AFK47388.1| unknown [Lotus japonicus] 56 1e-05 ref|XP_002532556.1| cysteine-type peptidase, putative [Ricinus c... 56 1e-05 >ref|XP_002300474.2| OTU-like cysteine protease family protein [Populus trichocarpa] gi|550349630|gb|EEE85279.2| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 208 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 MSPFEGA +EFDQTIF+V ND TI EG A NLVKEQ R Sbjct: 126 MSPFEGAPEEFDQTIFAVQNDRTIGQAEGHALNLVKEQQR 165 >ref|XP_006370448.1| hypothetical protein POPTR_0001s42650g [Populus trichocarpa] gi|550349629|gb|ERP67017.1| hypothetical protein POPTR_0001s42650g [Populus trichocarpa] Length = 155 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 MSPFEGA +EFDQTIF+V ND TI EG A NLVKEQ R Sbjct: 73 MSPFEGAPEEFDQTIFAVQNDRTIGQAEGHALNLVKEQQR 112 >ref|XP_006370447.1| hypothetical protein POPTR_0001s42650g [Populus trichocarpa] gi|550349628|gb|ERP67016.1| hypothetical protein POPTR_0001s42650g [Populus trichocarpa] Length = 112 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 MSPFEGA +EFDQTIF+V ND TI EG A NLVKEQ R Sbjct: 30 MSPFEGAPEEFDQTIFAVQNDRTIGQAEGHALNLVKEQQR 69 >gb|EOY12357.1| Cysteine-type peptidase, putative [Theobroma cacao] Length = 208 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 MSPFEGA +EFDQTIF+V + T+ +EGLA NLVK+Q R Sbjct: 126 MSPFEGAPEEFDQTIFAVQRNRTVGPVEGLALNLVKDQQR 165 >gb|AFK47388.1| unknown [Lotus japonicus] Length = 208 Score = 55.8 bits (133), Expect = 1e-05 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 MSP EGA +EFDQTIF+V N+ +I +EGLA N +K+QHR Sbjct: 126 MSPVEGAPEEFDQTIFAVENNRSIGPVEGLAVNFIKDQHR 165 >ref|XP_002532556.1| cysteine-type peptidase, putative [Ricinus communis] gi|223527711|gb|EEF29817.1| cysteine-type peptidase, putative [Ricinus communis] Length = 208 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 382 MSPFEGALKEFDQTIFSVHNDGTISSIEGLAQNLVKEQHR 501 +SPFEGA +EFDQTIF+V D T+ EGLA NLVKEQ R Sbjct: 126 ISPFEGAPEEFDQTIFAVQKDRTVGLAEGLALNLVKEQQR 165