BLASTX nr result
ID: Achyranthes22_contig00034326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034326 (641 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX95787.1| Mitochondrial substrate carrier family protein [T... 52 6e-07 >gb|EOX95787.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 399 Score = 52.4 bits (124), Expect(2) = 6e-07 Identities = 32/81 (39%), Positives = 40/81 (49%), Gaps = 17/81 (20%) Frame = +2 Query: 230 SAVIVNPLRIAKL--------------FNCF*MLPNLRSTQPCKNVALGDGSASSHECYP 367 SA+IVNPL +AK F P L+S+Q C LG EC Sbjct: 71 SAIIVNPLDVAKTRLQAQAAGVPYQTCFETNMFFPELKSSQSCARSVLGSEPVCPPECSR 130 Query: 368 YKG---LFYKVMCQDGFSRLW 421 YKG +FYKV+ Q+GF+RLW Sbjct: 131 YKGTLDVFYKVIRQEGFARLW 151 Score = 27.3 bits (59), Expect(2) = 6e-07 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 540 LSTYSPLVVG-PARSLIGMFYLLVLPVELARTRMQ 641 L+ Y PLV G ARS + PVELARTRMQ Sbjct: 190 LTPYVPLVAGIVARSFA---CVTCYPVELARTRMQ 221