BLASTX nr result
ID: Achyranthes22_contig00034202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034202 (238 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 49 8e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 49.3 bits (116), Expect(2) = 8e-06 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = +2 Query: 2 VILPLTGAGGFHCSVKPASCVPLHSKAHEPSGLRQRHMSQLPTWRGRA 145 VILPL AGG CSVKPAS L S+ Q H++QL W GRA Sbjct: 20 VILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRA 67 Score = 25.8 bits (55), Expect(2) = 8e-06 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +1 Query: 193 PINLMPLLRLQACVT 237 PI LMPLLRLQA T Sbjct: 83 PITLMPLLRLQAHAT 97