BLASTX nr result
ID: Achyranthes22_contig00034168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034168 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529817.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_004305312.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|ESW06416.1| hypothetical protein PHAVU_010G046200g [Phaseolus... 64 3e-08 ref|XP_006341663.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_002303270.2| pentatricopeptide repeat-containing family p... 63 4e-08 ref|XP_004235725.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 63 4e-08 ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_006465408.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006427149.1| hypothetical protein CICLE_v10024866mg [Citr... 62 1e-07 ref|XP_004506883.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CBI36234.3| unnamed protein product [Vitis vinifera] 60 2e-07 gb|EXB23110.1| hypothetical protein L484_016122 [Morus notabilis] 60 3e-07 gb|EOY26599.1| Tetratricopeptide repeat (TPR)-like superfamily p... 60 3e-07 gb|EMJ18480.1| hypothetical protein PRUPE_ppa017680mg [Prunus pe... 59 5e-07 gb|EXC45444.1| hypothetical protein L484_000697 [Morus notabilis] 59 7e-07 ref|XP_006416898.1| hypothetical protein EUTSA_v10006770mg [Eutr... 57 2e-06 ref|XP_002890108.1| pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_006306315.1| hypothetical protein CARUB_v10012185mg [Caps... 56 4e-06 >ref|XP_003529817.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Glycine max] Length = 882 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYK 117 HNI+KFIS+ VRREI VRD+EQFHHF+ G+CSC DE Y+ Sbjct: 843 HNIVKFISREVRREISVRDAEQFHHFKGGICSCTDEAYR 881 >ref|XP_004305312.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 877 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 H+ +KFIS+ VRREICVRD+E+FHHF++G C+C DE Y G Sbjct: 834 HSTVKFISKVVRREICVRDTEKFHHFKDGFCTCADEGYWG 873 >ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Vitis vinifera] Length = 872 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 HN +KFIS+ VRR I VRD+EQFHHF++GVCSC DE Y G Sbjct: 831 HNTVKFISKVVRRGISVRDTEQFHHFKDGVCSCGDEGYWG 870 >gb|ESW06416.1| hypothetical protein PHAVU_010G046200g [Phaseolus vulgaris] Length = 885 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYK 117 HNIIKFIS+ VRREI VRD+EQ H FR G+CSC +E Y+ Sbjct: 846 HNIIKFISREVRREISVRDAEQLHQFRGGICSCMNEGYR 884 >ref|XP_006341663.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Solanum tuberosum] Length = 876 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 H+ IKFIS+ VRREI VRD+EQFHHF++G C+C DE+Y G Sbjct: 835 HDTIKFISEVVRREIAVRDTEQFHHFKDGRCTCGDENYLG 874 >ref|XP_002303270.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550342491|gb|EEE78249.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 786 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYK 117 H+ +KFIS+ VRREI VRD+EQFHHF++G+CSC DE Y+ Sbjct: 748 HSTVKFISKIVRREISVRDTEQFHHFKDGLCSCGDEGYR 786 >ref|XP_004235725.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Solanum lycopersicum] Length = 876 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 H+ IKFIS+ VRREI VRD+EQFHHF++G C+C DE+Y G Sbjct: 835 HDTIKFISEVVRREIAVRDTEQFHHFKDGRCTCGDENYLG 874 >ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 HN++KFIS VRREI VRD E++HHF++GVCSC DE Y G Sbjct: 834 HNMVKFISTIVRREISVRDVEEYHHFKDGVCSCGDEGYWG 873 >ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 HN++KFIS VRREI VRD E++HHF++GVCSC DE Y G Sbjct: 834 HNMVKFISTIVRREISVRDVEEYHHFKDGVCSCGDEGYWG 873 >ref|XP_006465408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Citrus sinensis] Length = 879 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 HN +KFIS+ VRR+I VRD+E FHHF++G CSC DE Y G Sbjct: 833 HNTVKFISKIVRRDIFVRDTEHFHHFKDGTCSCGDEGYWG 872 >ref|XP_006427149.1| hypothetical protein CICLE_v10024866mg [Citrus clementina] gi|557529139|gb|ESR40389.1| hypothetical protein CICLE_v10024866mg [Citrus clementina] Length = 877 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKG 120 HN +KFIS+ VRR+I VRD+E FHHF++G CSC DE Y G Sbjct: 831 HNTVKFISKIVRRDIFVRDTEHFHHFKDGTCSCGDEGYWG 870 >ref|XP_004506883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cicer arietinum] Length = 881 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDY 114 HN +KFIS+ VRREI VRD+E+FH F+ G+CSC DE Y Sbjct: 844 HNTVKFISKEVRREISVRDAERFHRFKGGLCSCMDEGY 881 >emb|CBI36234.3| unnamed protein product [Vitis vinifera] Length = 906 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDE 108 HN +KFIS+ VRR I VRD+EQFHHF++GVCSC DE Sbjct: 831 HNTVKFISKVVRRGISVRDTEQFHHFKDGVCSCGDE 866 >gb|EXB23110.1| hypothetical protein L484_016122 [Morus notabilis] Length = 880 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDY 114 H+ +KFIS VRREI VRD E+FHHF++G+CSC DE Y Sbjct: 839 HDTVKFISTVVRREISVRDVEEFHHFKDGICSCGDEGY 876 >gb|EOY26599.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 873 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKGT 123 H+ IKFIS+ VRREI VRD+EQFHHF++G CSC D GT Sbjct: 832 HSTIKFISKIVRREITVRDTEQFHHFKDGTCSCGDVGILGT 872 >gb|EMJ18480.1| hypothetical protein PRUPE_ppa017680mg [Prunus persica] Length = 790 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDYKGT 123 H+ IKFIS+ VRR+I VRD+E+FHHF++G C+C DE Y G+ Sbjct: 747 HSTIKFISKVVRRDISVRDTEKFHHFKDGSCTCGDEGYWGS 787 >gb|EXC45444.1| hypothetical protein L484_000697 [Morus notabilis] Length = 880 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYDEDY 114 H+ +KFIS VRREI VRD E++HHF++G+CSC DE Y Sbjct: 839 HDTVKFISTVVRREISVRDVEEYHHFKDGICSCGDEGY 876 >ref|XP_006416898.1| hypothetical protein EUTSA_v10006770mg [Eutrema salsugineum] gi|557094669|gb|ESQ35251.1| hypothetical protein EUTSA_v10006770mg [Eutrema salsugineum] Length = 867 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYD 105 H+ +KFIS+ VRREI VRD+E FHHFR+G CSC D Sbjct: 833 HDTVKFISKTVRREISVRDAEHFHHFRDGECSCGD 867 >ref|XP_002890108.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335950|gb|EFH66367.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 866 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSCYD 105 H+ +KFIS+ VRREI VRDSE FHHF++G CSC D Sbjct: 832 HDTVKFISKTVRREISVRDSEHFHHFKDGECSCGD 866 >ref|XP_006306315.1| hypothetical protein CARUB_v10012185mg [Capsella rubella] gi|482575026|gb|EOA39213.1| hypothetical protein CARUB_v10012185mg [Capsella rubella] Length = 866 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 HNIIKFISQNVRREICVRDSEQFHHFRNGVCSC 99 H+ +KFIS+ VRREI VRD+E FHHFR+G CSC Sbjct: 832 HDTVKFISKTVRREISVRDAEHFHHFRDGECSC 864