BLASTX nr result
ID: Achyranthes22_contig00034115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00034115 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135709.1| PREDICTED: glutamate-rich WD repeat-containi... 74 2e-11 gb|EMJ03209.1| hypothetical protein PRUPE_ppa005177mg [Prunus pe... 73 3e-11 ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containi... 68 1e-09 ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citr... 68 1e-09 ref|XP_004287549.1| PREDICTED: glutamate-rich WD repeat-containi... 68 1e-09 gb|EOY30472.1| Transducin family protein / WD-40 repeat family p... 67 2e-09 gb|EOY30471.1| Transducin family protein / WD-40 repeat family p... 67 2e-09 ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containi... 67 2e-09 ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communi... 67 2e-09 ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containi... 64 2e-08 ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containi... 60 2e-07 ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containi... 60 2e-07 ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containi... 60 2e-07 ref|NP_001275436.1| glutamate-rich WD repeat-containing protein ... 60 2e-07 ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containi... 59 7e-07 ref|XP_002306305.2| transducin family protein [Populus trichocar... 59 9e-07 ref|XP_004173317.1| PREDICTED: glutamate-rich WD repeat-containi... 59 9e-07 ref|XP_002309975.2| transducin family protein [Populus trichocar... 57 3e-06 ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containi... 56 4e-06 ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containi... 55 1e-05 >ref|XP_004135709.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Cucumis sativus] Length = 475 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RK+KGS NG ++SSS+P+V A+VWRPGVD +EE EELQCD Sbjct: 2 VRSIKNRKKAKRKSKGSSNGVAASSSSIPSVP---AKVWRPGVDKLEEGEELQCD 53 >gb|EMJ03209.1| hypothetical protein PRUPE_ppa005177mg [Prunus persica] Length = 473 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNKGSK G+ S+SS++P++ A+VW+PGVD +EE EELQCD Sbjct: 2 VRSIKNPKKAKRKNKGSKKGDGSSSSAIPSMP---AKVWQPGVDKLEEGEELQCD 53 >ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Citrus sinensis] gi|568882164|ref|XP_006493909.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Citrus sinensis] gi|568882166|ref|XP_006493910.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X3 [Citrus sinensis] gi|568882168|ref|XP_006493911.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X4 [Citrus sinensis] gi|568882170|ref|XP_006493912.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X5 [Citrus sinensis] Length = 475 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNK +K G+ S+SSS+P++ +VW+PGVD +EE EELQCD Sbjct: 2 VRSIKNPKKAKRKNKVAKKGDGSSSSSIPSLP---TKVWQPGVDKLEEGEELQCD 53 >ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|567857522|ref|XP_006421444.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523316|gb|ESR34683.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523317|gb|ESR34684.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] Length = 475 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNK +K G+ S+SSS+P++ +VW+PGVD +EE EELQCD Sbjct: 2 VRSIKNPKKAKRKNKVAKKGDGSSSSSIPSLP---TKVWQPGVDKLEEGEELQCD 53 >ref|XP_004287549.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 508 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNK SK G+ S+SSS P A+VW+PGVD +EE EELQCD Sbjct: 2 VRSIKNPKKAKRKNKASKKGDGSSSSSGP-----PAKVWQPGVDKLEEGEELQCD 51 >gb|EOY30472.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] Length = 473 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +1 Query: 133 RSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 R++KN KKA+RKNKGSK G+ +++SS +V + RVW+PGVD +EE EELQCD Sbjct: 3 RTLKNPKKAKRKNKGSKKGDGASASS--SVPTIQPRVWQPGVDELEEGEELQCD 54 >gb|EOY30471.1| Transducin family protein / WD-40 repeat family protein isoform 1 [Theobroma cacao] Length = 475 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +1 Query: 133 RSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 R++KN KKA+RKNKGSK G+ +++SS +V + RVW+PGVD +EE EELQCD Sbjct: 3 RTLKNPKKAKRKNKGSKKGDGASASS--SVPTIQPRVWQPGVDELEEGEELQCD 54 >ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Vitis vinifera] gi|297738673|emb|CBI27918.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNKGSK GE S+S V + +VW+PGVD +EE EELQCD Sbjct: 2 VRSIKNPKKAKRKNKGSKKGEGSSS-----VPSLPTKVWQPGVDKLEEGEELQCD 51 >ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communis] gi|223532868|gb|EEF34640.1| WD-repeat protein, putative [Ricinus communis] Length = 476 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RKNKGSK G+ S+SS + + +VW+PGVD +EE EEL+CD Sbjct: 2 VRSIKNPKKAKRKNKGSKQGDASSSS----IPTMPTKVWQPGVDKLEEGEELECD 52 >ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Solanum tuberosum] Length = 470 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+RKNK +K GE S+ S V + A+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKRKNKQAKKGEGSSDS----VPSLPAKVWQPGVDKLEEGEELQCD 52 >ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 469 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+RKNK +K GE S+ S V + A+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKRKNK-AKKGEGSSDS----VPSLPAKVWQPGVDKLEEGEELQCD 51 >ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 2 [Solanum lycopersicum] Length = 468 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+RKNK +K GE S+ S V + A+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKRKNK-AKKGEGSSDS----VPSLPAKVWQPGVDKLEEGEELQCD 51 >ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 1 [Solanum lycopersicum] Length = 475 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+RKNK +K GE S+ S V + A+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKRKNK-AKKGEGSSDS----VPSLPAKVWQPGVDKLEEGEELQCD 51 >ref|NP_001275436.1| glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] gi|82400122|gb|ABB72800.1| WD-40 repeat protein-like protein [Solanum tuberosum] Length = 464 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+RKNK +K GE S+ S V + A+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKRKNK-AKKGEGSSDS----VPSLPAKVWQPGVDKLEEGEELQCD 51 >ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Glycine max] Length = 474 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 133 RSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 R IK+ +KA+ K KGSK S+SS P E+ A+VW+PGVD +EE EELQCD Sbjct: 3 RGIKHRQKAKSKKKGSKKEGGSSSSLAP---EIPAKVWQPGVDKLEEGEELQCD 53 >ref|XP_002306305.2| transducin family protein [Populus trichocarpa] gi|550338336|gb|EEE93301.2| transducin family protein [Populus trichocarpa] Length = 472 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIK KKA+RKNK K E+S+SSS+P++ +VW+PGVD + E+EEL+CD Sbjct: 2 VRSIKKPKKAKRKNK--KGDESSSSSSIPSMP---TKVWQPGVDKLGEEEELECD 51 >ref|XP_004173317.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like, partial [Cucumis sativus] Length = 465 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 157 AERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 ++ K+KGS NG ++SSS+P+V A+VWRPGVD +EE EELQCD Sbjct: 1 SQEKSKGSSNGVAASSSSIPSVP---AKVWRPGVDKLEEGEELQCD 43 >ref|XP_002309975.2| transducin family protein [Populus trichocarpa] gi|550334174|gb|EEE90425.2| transducin family protein [Populus trichocarpa] Length = 459 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RSIKN KKA+RK K K +S+SSS+P++ +VW+PGVD +EE EEL+CD Sbjct: 2 VRSIKNPKKAKRKIK--KGDGSSSSSSIPSMP---TKVWQPGVDNLEEGEELECD 51 >ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Glycine max] Length = 473 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +1 Query: 133 RSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 R IK+ +KA+ K K SK S+SS P E+ A+VW+PGVD +EE EELQCD Sbjct: 3 RGIKHRQKAKSKKKVSKKESGSSSSLAP---EIPAKVWQPGVDKLEEGEELQCD 53 >ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] Length = 463 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +1 Query: 130 LRSIKNLKKAERKNKGSKNGETSTSSSLPAVDEVAARVWRPGVDTMEEDEELQCD 294 +RS+KN KKA+ NK GE S+ S V +AA+VW+PGVD +EE EELQCD Sbjct: 2 VRSLKNPKKAKTNNK---KGEGSSDS----VPSLAAKVWQPGVDELEEGEELQCD 49