BLASTX nr result
ID: Achyranthes22_contig00033400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00033400 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357835.1| PREDICTED: putative pentatricopeptide repeat... 136 2e-30 ref|XP_006450549.1| hypothetical protein CICLE_v10008244mg [Citr... 136 2e-30 ref|XP_006450548.1| hypothetical protein CICLE_v10008244mg [Citr... 136 2e-30 ref|XP_004232338.1| PREDICTED: putative pentatricopeptide repeat... 135 4e-30 ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat... 133 3e-29 ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat... 132 6e-29 gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, put... 125 4e-27 gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, put... 125 4e-27 gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, put... 125 4e-27 ref|XP_002308767.2| hypothetical protein POPTR_0006s00830g, part... 125 6e-27 gb|ESW09419.1| hypothetical protein PHAVU_009G126100g [Phaseolus... 125 7e-27 gb|EMJ16555.1| hypothetical protein PRUPE_ppa005519mg [Prunus pe... 125 7e-27 ref|XP_004305450.1| PREDICTED: putative pentatricopeptide repeat... 124 2e-26 ref|XP_002532784.1| pentatricopeptide repeat-containing protein,... 123 2e-26 ref|XP_004499962.1| PREDICTED: putative pentatricopeptide repeat... 121 8e-26 ref|XP_003621847.1| Pentatricopeptide repeat-containing protein ... 119 4e-25 emb|CBI26532.3| unnamed protein product [Vitis vinifera] 119 5e-25 ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat... 119 5e-25 emb|CAN63846.1| hypothetical protein VITISV_010038 [Vitis vinifera] 119 5e-25 ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat... 117 2e-24 >ref|XP_006357835.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X1 [Solanum tuberosum] gi|565383043|ref|XP_006357836.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X2 [Solanum tuberosum] gi|565383045|ref|XP_006357837.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X3 [Solanum tuberosum] Length = 460 Score = 136 bits (343), Expect = 2e-30 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R+LKRHG P+L+TYNILI GLCK+GR AR L EL +SG++PNAITYTTVMKCCF+Y Sbjct: 174 RSLKRHGFIPQLVTYNILIHGLCKSGRGNVAREFLNELVESGHIPNAITYTTVMKCCFRY 233 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTVA 2 +F+EGL IF EM++KGYT+D F YCTVA Sbjct: 234 RQFEEGLKIFAEMRNKGYTYDAFAYCTVA 262 >ref|XP_006450549.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|557553775|gb|ESR63789.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] Length = 319 Score = 136 bits (343), Expect = 2e-30 Identities = 62/88 (70%), Positives = 71/88 (80%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R L++HG PEL+TYNILI+GLCKAGR + ARWIL EL DSG+ PNAITYTT+MKCCF+ Sbjct: 34 RGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKCCFRN 93 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 K+ GL I MK KGYTFDGFGYCTV Sbjct: 94 RKYKLGLEILSAMKRKGYTFDGFGYCTV 121 >ref|XP_006450548.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] gi|568844658|ref|XP_006476201.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X1 [Citrus sinensis] gi|568844660|ref|XP_006476202.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X2 [Citrus sinensis] gi|568844662|ref|XP_006476203.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X3 [Citrus sinensis] gi|557553774|gb|ESR63788.1| hypothetical protein CICLE_v10008244mg [Citrus clementina] Length = 456 Score = 136 bits (343), Expect = 2e-30 Identities = 62/88 (70%), Positives = 71/88 (80%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R L++HG PEL+TYNILI+GLCKAGR + ARWIL EL DSG+ PNAITYTT+MKCCF+ Sbjct: 171 RGLQKHGFVPELVTYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKCCFRN 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 K+ GL I MK KGYTFDGFGYCTV Sbjct: 231 RKYKLGLEILSAMKRKGYTFDGFGYCTV 258 >ref|XP_004232338.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform 1 [Solanum lycopersicum] gi|460373057|ref|XP_004232339.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform 2 [Solanum lycopersicum] Length = 460 Score = 135 bits (341), Expect = 4e-30 Identities = 60/88 (68%), Positives = 73/88 (82%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R+LKRHG P+L+TYNILI GLCK+GR AR L EL +SG++PNAITYTTVMKCCF+Y Sbjct: 174 RSLKRHGFTPQLVTYNILIHGLCKSGRGNVAREFLNELVESGHIPNAITYTTVMKCCFRY 233 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 +F+EGL IF EM++KGYT+D F YCTV Sbjct: 234 RQFEEGLKIFAEMRNKGYTYDAFAYCTV 261 >ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum lycopersicum] Length = 460 Score = 133 bits (334), Expect = 3e-29 Identities = 61/89 (68%), Positives = 72/89 (80%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R++KRHG P+L TYNILI GLCK+GR K AR L EL +SG++PNAITYTTVMKCCFK Sbjct: 174 RSIKRHGFIPQLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFKC 233 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTVA 2 +F+EGL IF EM+ KGYT+D F YCTVA Sbjct: 234 EQFEEGLKIFAEMRRKGYTYDAFAYCTVA 262 >ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum tuberosum] Length = 460 Score = 132 bits (331), Expect = 6e-29 Identities = 60/89 (67%), Positives = 72/89 (80%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R++KRHG P+L TYNILI GLCK+GR K AR L EL +SG++PNAITYTTVMKCCF+ Sbjct: 174 RSIKRHGFIPQLATYNILIHGLCKSGRGKTAREFLNELVESGHIPNAITYTTVMKCCFRC 233 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTVA 2 +F+EGL IF EM+ KGYT+D F YCTVA Sbjct: 234 RQFEEGLKIFSEMRRKGYTYDAFAYCTVA 262 >gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700993|gb|EOX92889.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] Length = 490 Score = 125 bits (315), Expect = 4e-27 Identities = 57/88 (64%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG PEL+TYNIL+ GLCK GR A I E+ +SG++PNAITYT V++CCF+ Sbjct: 204 RNLQRHGFVPELMTYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRK 263 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 KF+EGL + EMKSKGYTFDGF YCTV Sbjct: 264 RKFEEGLELLSEMKSKGYTFDGFAYCTV 291 >gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700991|gb|EOX92887.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 457 Score = 125 bits (315), Expect = 4e-27 Identities = 57/88 (64%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG PEL+TYNIL+ GLCK GR A I E+ +SG++PNAITYT V++CCF+ Sbjct: 171 RNLQRHGFVPELMTYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRK 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 KF+EGL + EMKSKGYTFDGF YCTV Sbjct: 231 RKFEEGLELLSEMKSKGYTFDGFAYCTV 258 >gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 505 Score = 125 bits (315), Expect = 4e-27 Identities = 57/88 (64%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG PEL+TYNIL+ GLCK GR A I E+ +SG++PNAITYT V++CCF+ Sbjct: 219 RNLQRHGFVPELMTYNILVSGLCKIGRLGLAMRIFKEIVESGHVPNAITYTPVLRCCFRK 278 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 KF+EGL + EMKSKGYTFDGF YCTV Sbjct: 279 RKFEEGLELLSEMKSKGYTFDGFAYCTV 306 >ref|XP_002308767.2| hypothetical protein POPTR_0006s00830g, partial [Populus trichocarpa] gi|550335172|gb|EEE92290.2| hypothetical protein POPTR_0006s00830g, partial [Populus trichocarpa] Length = 342 Score = 125 bits (314), Expect = 6e-27 Identities = 58/93 (62%), Positives = 70/93 (75%) Frame = -2 Query: 283 KDANRRNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMK 104 K+A+ + RHG P L+TYNILI GLCKA + K ARW+L EL SG +PN ITYTTVM+ Sbjct: 90 KEASIKPDIRHGFVPSLVTYNILINGLCKAWKLKTARWMLKELGASGLVPNVITYTTVMR 149 Query: 103 CCFKYGKFDEGLAIFREMKSKGYTFDGFGYCTV 5 CCF+ +F++GL IF EM KGYTFDGF YCTV Sbjct: 150 CCFRSRRFEQGLEIFEEMIDKGYTFDGFAYCTV 182 >gb|ESW09419.1| hypothetical protein PHAVU_009G126100g [Phaseolus vulgaris] Length = 498 Score = 125 bits (313), Expect = 7e-27 Identities = 57/88 (64%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG P+++TYN LI GLCKA R K AR +L E +SGY PNAITYTTVMKCCF+ Sbjct: 212 RNLQRHGFVPQVLTYNALINGLCKAKRLKDARKVLKEFGESGYEPNAITYTTVMKCCFRC 271 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 G F++GL I EM++ G+TFDGF YCTV Sbjct: 272 GYFEQGLEILSEMRNLGFTFDGFAYCTV 299 >gb|EMJ16555.1| hypothetical protein PRUPE_ppa005519mg [Prunus persica] Length = 456 Score = 125 bits (313), Expect = 7e-27 Identities = 59/88 (67%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG P+L+TYNILI GLCKA R + AR +L EL +S PNAITYTTVMKCCF+ Sbjct: 171 RNLQRHGFVPQLVTYNILINGLCKARRLRQARTMLRELGESDLEPNAITYTTVMKCCFRS 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 ++D+GL I EMKSKGYTFD F YCTV Sbjct: 231 KQYDKGLDIMSEMKSKGYTFDSFAYCTV 258 >ref|XP_004305450.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Fragaria vesca subsp. vesca] Length = 456 Score = 124 bits (310), Expect = 2e-26 Identities = 57/88 (64%), Positives = 70/88 (79%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG P L+TYNI+I GLCKA R + AR IL +L +SG++P+AITYTTV+K CF+ Sbjct: 171 RNLQRHGFAPTLVTYNIIISGLCKARRVRQARKILQDLVESGHVPDAITYTTVLKSCFRS 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 ++D GL I EMKSKGYTFDGF YCTV Sbjct: 231 KQYDHGLEIMSEMKSKGYTFDGFAYCTV 258 >ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527472|gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 123 bits (309), Expect = 2e-26 Identities = 59/88 (67%), Positives = 69/88 (78%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R+LK+HG P+LITYNILI GLCK R +AAR +L EL SGY+PNAITYTTVMK CF+ Sbjct: 201 RSLKQHGFVPQLITYNILINGLCKDRRLRAARSMLKELETSGYVPNAITYTTVMKFCFRS 260 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 +F +GL I +EM KGYTFDGF YCTV Sbjct: 261 RRFKQGLEILQEMIDKGYTFDGFAYCTV 288 >ref|XP_004499962.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X1 [Cicer arietinum] gi|502128438|ref|XP_004499963.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X2 [Cicer arietinum] gi|502128441|ref|XP_004499964.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X3 [Cicer arietinum] Length = 457 Score = 121 bits (304), Expect = 8e-26 Identities = 55/88 (62%), Positives = 67/88 (76%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG P+++TYN +I GLCKA R AR +L E + GY PNAITYTTVMKCCF+ Sbjct: 172 RNLQRHGFVPQVLTYNTMINGLCKAKRLGDARRVLREFCEYGYEPNAITYTTVMKCCFRC 231 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 G+ ++GL I EM+ KGYTFDGF YCTV Sbjct: 232 GRLEQGLEILSEMRMKGYTFDGFAYCTV 259 >ref|XP_003621847.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496862|gb|AES78065.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 457 Score = 119 bits (298), Expect = 4e-25 Identities = 54/88 (61%), Positives = 66/88 (75%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+R G PE++TYN +I GLCKA R AR +L E D G+ PNAITYTTVMKCCF+ Sbjct: 172 RNLRRRGFVPEVLTYNAMINGLCKARRLADARRVLNEFCDFGFEPNAITYTTVMKCCFRC 231 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 G+ ++GL I EM+ KG+TFDGF YCTV Sbjct: 232 GRLEQGLEILSEMRRKGFTFDGFAYCTV 259 >emb|CBI26532.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 119 bits (297), Expect = 5e-25 Identities = 56/88 (63%), Positives = 67/88 (76%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R L+R G PEL+TYNILI GLCK+ + AAR IL EL +SG +P+AITYTTVMKCCF+ Sbjct: 155 RYLQRQGFVPELVTYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRS 214 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 +F++G IF EMKSKGY FD F YC V Sbjct: 215 RQFEQGFEIFSEMKSKGYAFDAFSYCAV 242 >ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Vitis vinifera] Length = 457 Score = 119 bits (297), Expect = 5e-25 Identities = 56/88 (63%), Positives = 67/88 (76%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R L+R G PEL+TYNILI GLCK+ + AAR IL EL +SG +P+AITYTTVMKCCF+ Sbjct: 171 RYLQRQGFVPELVTYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRS 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 +F++G IF EMKSKGY FD F YC V Sbjct: 231 RQFEQGFEIFSEMKSKGYAFDAFSYCAV 258 >emb|CAN63846.1| hypothetical protein VITISV_010038 [Vitis vinifera] Length = 457 Score = 119 bits (297), Expect = 5e-25 Identities = 56/88 (63%), Positives = 67/88 (76%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 R L+R G PEL+TYNILI GLCK+ + AAR IL EL +SG +P+AITYTTVMKCCF+ Sbjct: 171 RYLQRQGFVPELVTYNILINGLCKSRKLNAARRILRELGESGNVPDAITYTTVMKCCFRS 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTV 5 +F++G IF EMKSKGY FD F YC V Sbjct: 231 RQFEQGFEIFSEMKSKGYAFDAFSYCAV 258 >ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449468117|ref|XP_004151768.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449532400|ref|XP_004173169.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] Length = 456 Score = 117 bits (292), Expect = 2e-24 Identities = 53/89 (59%), Positives = 67/89 (75%) Frame = -2 Query: 268 RNLKRHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKY 89 RNL+RHG P+L+TYNILI GLCK R +AA +L E DSG PNA+TYTT+MK CF+ Sbjct: 171 RNLQRHGFIPQLVTYNILINGLCKVDRLRAAIRMLNEAMDSGLEPNAVTYTTLMKSCFRS 230 Query: 88 GKFDEGLAIFREMKSKGYTFDGFGYCTVA 2 +++ G IF +MK+KGY FDGF YCTV+ Sbjct: 231 RQYERGFEIFSKMKNKGYAFDGFAYCTVS 259 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/84 (33%), Positives = 47/84 (55%) Frame = -2 Query: 256 RHGCKPELITYNILIEGLCKAGRAKAARWILTELRDSGYLPNAITYTTVMKCCFKYGKFD 77 R G P+++TYN LI+G C+ AA +L +R++G P+ ITY +++ + + Sbjct: 35 RIGVLPDVVTYNTLIDGYCRFSGMDAAYSVLYRMREAGISPDVITYNSLIAGATRNFSLE 94 Query: 76 EGLAIFREMKSKGYTFDGFGYCTV 5 + L +F EM G T D + Y T+ Sbjct: 95 QSLDLFEEMLQSGITPDIWSYNTL 118