BLASTX nr result
ID: Achyranthes22_contig00033357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00033357 (1067 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004488468.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-05 >ref|XP_004488468.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like, partial [Cicer arietinum] Length = 274 Score = 57.4 bits (137), Expect = 1e-05 Identities = 35/91 (38%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = +1 Query: 799 FLHSVSEQCKFGFT--DLNHPISLFQQMTSLQPLPSIYVYIGLFAAMSKMKRLHPHSTII 972 FL S S +F D+NH +S F +M S+ P PSI + + + KMK + T I Sbjct: 37 FLLSFSSHSRFNSNEFDVNHAVSSFHRMLSMNPTPSIVQFNTILTSFVKMKH---YPTAI 93 Query: 973 SLITDLQISYGIQLNLHLLGSLANCYCHLGR 1065 SL L+ + GI+ N+ L NCYCHLG+ Sbjct: 94 SLSHQLEFN-GIKPNIVTFNILINCYCHLGQ 123