BLASTX nr result
ID: Achyranthes22_contig00033323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00033323 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513692.1| pectin acetylesterase, putative [Ricinus com... 57 3e-06 >ref|XP_002513692.1| pectin acetylesterase, putative [Ricinus communis] gi|223547600|gb|EEF49095.1| pectin acetylesterase, putative [Ricinus communis] Length = 449 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -3 Query: 344 DWYFERNITKLIDCPYPCNHNCHNLIASGGEDKKYTTS 231 DWYF RN +K IDCPYPC+ CHNLI + +D+++ ++ Sbjct: 369 DWYFSRNRSKEIDCPYPCDDTCHNLIPTARDDRRFLSN 406