BLASTX nr result
ID: Achyranthes22_contig00033310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00033310 (836 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006281326.1| hypothetical protein CARUB_v10027380mg [Caps... 66 2e-08 ref|XP_004241206.1| PREDICTED: transcription elongation factor B... 66 2e-08 ref|NP_568900.1| BTB/POZ domain-containing protein [Arabidopsis ... 66 2e-08 ref|XP_006424933.1| hypothetical protein CICLE_v10029658mg [Citr... 65 4e-08 ref|XP_001784798.1| predicted protein [Physcomitrella patens] gi... 64 5e-08 gb|EPS59254.1| hypothetical protein M569_15556 [Genlisea aurea] 64 7e-08 gb|EOY33909.1| BTB/POZ domain-containing protein [Theobroma cacao] 64 9e-08 ref|XP_002972199.1| hypothetical protein SELMODRAFT_96367 [Selag... 63 1e-07 gb|EXC10738.1| Transcription elongation factor B polypeptide 1 [... 63 1e-07 ref|XP_004291523.1| PREDICTED: transcription elongation factor B... 63 1e-07 gb|EMJ07385.1| hypothetical protein PRUPE_ppa013881mg [Prunus pe... 62 2e-07 ref|XP_006850441.1| hypothetical protein AMTR_s00165p00063860 [A... 62 3e-07 ref|XP_002314149.1| hypothetical protein POPTR_0009s04270g [Popu... 62 3e-07 ref|XP_002520493.1| Transcription elongation factor B polypeptid... 61 4e-07 ref|XP_004145280.1| PREDICTED: transcription elongation factor B... 60 1e-06 emb|CBI16050.3| unnamed protein product [Vitis vinifera] 60 1e-06 ref|XP_002282124.1| PREDICTED: transcription elongation factor B... 60 1e-06 ref|NP_001236759.1| uncharacterized protein LOC100500097 [Glycin... 60 1e-06 gb|ESW22352.1| hypothetical protein PHAVU_005G146900g [Phaseolus... 59 2e-06 ref|NP_001235513.1| uncharacterized protein LOC100305702 [Glycin... 59 2e-06 >ref|XP_006281326.1| hypothetical protein CARUB_v10027380mg [Capsella rubella] gi|482550030|gb|EOA14224.1| hypothetical protein CARUB_v10027380mg [Capsella rubella] Length = 123 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQYS GKE EFHIEPELTLELMMAANYLHT Sbjct: 92 WSLQYSRGKETEFHIEPELTLELMMAANYLHT 123 >ref|XP_004241206.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform 1 [Solanum lycopersicum] gi|460391192|ref|XP_004241207.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform 2 [Solanum lycopersicum] gi|565368319|ref|XP_006350794.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Solanum tuberosum] Length = 98 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQY+SGKE EFHIEPE+TLELMMAANYLHT Sbjct: 67 WSLQYASGKETEFHIEPEITLELMMAANYLHT 98 >ref|NP_568900.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|297790272|ref|XP_002863037.1| SKP1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297793455|ref|XP_002864612.1| SKP1 family protein [Arabidopsis lyrata subsp. lyrata] gi|567177353|ref|XP_006400994.1| hypothetical protein EUTSA_v10015122mg [Eutrema salsugineum] gi|9759236|dbj|BAB09760.1| unnamed protein product [Arabidopsis thaliana] gi|15028385|gb|AAK76669.1| putative elongin protein [Arabidopsis thaliana] gi|20465563|gb|AAM20264.1| unknown protein [Arabidopsis thaliana] gi|297308839|gb|EFH39296.1| SKP1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297310447|gb|EFH40871.1| SKP1 family protein [Arabidopsis lyrata subsp. lyrata] gi|332009765|gb|AED97148.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|557102084|gb|ESQ42447.1| hypothetical protein EUTSA_v10015122mg [Eutrema salsugineum] Length = 96 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQYS GKE EFHIEPELTLELMMAANYLHT Sbjct: 65 WSLQYSRGKETEFHIEPELTLELMMAANYLHT 96 >ref|XP_006424933.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] gi|568870426|ref|XP_006488405.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Citrus sinensis] gi|557526867|gb|ESR38173.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] Length = 98 Score = 64.7 bits (156), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQYS GKE +FHIEPELTLELMMAANYLHT Sbjct: 67 WSLQYSRGKETDFHIEPELTLELMMAANYLHT 98 >ref|XP_001784798.1| predicted protein [Physcomitrella patens] gi|162663632|gb|EDQ50386.1| predicted protein [Physcomitrella patens] Length = 99 Score = 64.3 bits (155), Expect = 5e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQ+SSGKE EFHIEPE+TL+LMMAANYLHT Sbjct: 68 WSLQFSSGKETEFHIEPEITLDLMMAANYLHT 99 >gb|EPS59254.1| hypothetical protein M569_15556 [Genlisea aurea] Length = 98 Score = 63.9 bits (154), Expect = 7e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQY+SG+E EFHIEPELTLELMMAAN+LHT Sbjct: 67 WSLQYASGRETEFHIEPELTLELMMAANFLHT 98 >gb|EOY33909.1| BTB/POZ domain-containing protein [Theobroma cacao] Length = 98 Score = 63.5 bits (153), Expect = 9e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQYS GKE EF+IEPELTLELMMAANYLHT Sbjct: 67 WSLQYSRGKETEFYIEPELTLELMMAANYLHT 98 >ref|XP_002972199.1| hypothetical protein SELMODRAFT_96367 [Selaginella moellendorffii] gi|302791489|ref|XP_002977511.1| hypothetical protein SELMODRAFT_106838 [Selaginella moellendorffii] gi|300154881|gb|EFJ21515.1| hypothetical protein SELMODRAFT_106838 [Selaginella moellendorffii] gi|300160498|gb|EFJ27116.1| hypothetical protein SELMODRAFT_96367 [Selaginella moellendorffii] Length = 99 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQ++SGKE EFHIEPE+TLEL+MAANYLHT Sbjct: 68 WSLQFASGKETEFHIEPEMTLELLMAANYLHT 99 >gb|EXC10738.1| Transcription elongation factor B polypeptide 1 [Morus notabilis] Length = 98 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W+L+++SGKE EFHIEPELTLELMMAANYLHT Sbjct: 67 WNLEFASGKETEFHIEPELTLELMMAANYLHT 98 >ref|XP_004291523.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Fragaria vesca subsp. vesca] Length = 98 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W+LQ++SGK+ EFHIEPELTLELMMAANYLHT Sbjct: 67 WNLQFASGKQTEFHIEPELTLELMMAANYLHT 98 >gb|EMJ07385.1| hypothetical protein PRUPE_ppa013881mg [Prunus persica] Length = 98 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W+LQY+SGK+ EFHIEPEL LELMMAANYLHT Sbjct: 67 WNLQYASGKQTEFHIEPELVLELMMAANYLHT 98 >ref|XP_006850441.1| hypothetical protein AMTR_s00165p00063860 [Amborella trichopoda] gi|548854086|gb|ERN12022.1| hypothetical protein AMTR_s00165p00063860 [Amborella trichopoda] Length = 98 Score = 62.0 bits (149), Expect = 3e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQ++SGKE EF+IEPE+TLELMMAANYLHT Sbjct: 67 WSLQFASGKETEFYIEPEITLELMMAANYLHT 98 >ref|XP_002314149.1| hypothetical protein POPTR_0009s04270g [Populus trichocarpa] gi|222850557|gb|EEE88104.1| hypothetical protein POPTR_0009s04270g [Populus trichocarpa] Length = 98 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQY++GKE EF IEPELTLELMMAANYLHT Sbjct: 67 WSLQYANGKETEFPIEPELTLELMMAANYLHT 98 >ref|XP_002520493.1| Transcription elongation factor B polypeptide, putative [Ricinus communis] gi|223540335|gb|EEF41906.1| Transcription elongation factor B polypeptide, putative [Ricinus communis] Length = 98 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQY+ GKE EF IEPELTLELMMAANYLHT Sbjct: 67 WSLQYAKGKETEFPIEPELTLELMMAANYLHT 98 >ref|XP_004145280.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] gi|449474021|ref|XP_004154051.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] gi|449508510|ref|XP_004163332.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] Length = 98 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W+LQ++SGKE EF IEPELTLELMMAANYLHT Sbjct: 67 WNLQFASGKETEFPIEPELTLELMMAANYLHT 98 >emb|CBI16050.3| unnamed protein product [Vitis vinifera] Length = 74 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQ++SGK+ EF IEPELTLELMMAANYLHT Sbjct: 43 WSLQFASGKDTEFPIEPELTLELMMAANYLHT 74 >ref|XP_002282124.1| PREDICTED: transcription elongation factor B polypeptide 1 [Vitis vinifera] Length = 98 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 WSLQ++SGK+ EF IEPELTLELMMAANYLHT Sbjct: 67 WSLQFASGKDTEFPIEPELTLELMMAANYLHT 98 >ref|NP_001236759.1| uncharacterized protein LOC100500097 [Glycine max] gi|571513894|ref|XP_006596971.1| PREDICTED: uncharacterized protein LOC100500097 isoform X1 [Glycine max] gi|255629123|gb|ACU14906.1| unknown [Glycine max] Length = 98 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W LQ++SGKE EF IEPELTLELMMAANYLHT Sbjct: 67 WHLQFASGKETEFSIEPELTLELMMAANYLHT 98 >gb|ESW22352.1| hypothetical protein PHAVU_005G146900g [Phaseolus vulgaris] Length = 145 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W LQ++SGKE EF IEPELTLELMMAANYLHT Sbjct: 114 WHLQFASGKETEFPIEPELTLELMMAANYLHT 145 >ref|NP_001235513.1| uncharacterized protein LOC100305702 [Glycine max] gi|255626357|gb|ACU13523.1| unknown [Glycine max] Length = 98 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 WSLQYSSGKEIEFHIEPELTLELMMAANYLHT 98 W LQ++SGKE EF IEPELTLELMMAANYLHT Sbjct: 67 WHLQFASGKETEFPIEPELTLELMMAANYLHT 98