BLASTX nr result
ID: Achyranthes22_contig00033292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00033292 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588293.1| chloroplast hypothetical protein [Zea mays subs... 44 1e-06 >ref|YP_588293.1| chloroplast hypothetical protein [Zea mays subsp. mays] gi|40795075|gb|AAR91119.1| chloroplast hypothetical protein (mitochondrion) [Zea mays] Length = 121 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -1 Query: 226 YIDSTQFFRFGRSIYDFSFMDVDKILPFT 140 Y DST+ +F SIYDF+FMDVDKILPF+ Sbjct: 17 YYDSTEGCQFVSSIYDFAFMDVDKILPFS 45 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = -2 Query: 120 HNLKVKDEVQTRKCL*WISRHGPRDKEGHINLQNGSGVEN 1 H+L V EVQ RK L WI RH P ++G + + GVEN Sbjct: 51 HSLNVNGEVQKRKGLRWIPRH-PETRKGVASDEMLRGVEN 89