BLASTX nr result
ID: Achyranthes22_contig00029739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00029739 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307746.1| PREDICTED: methylesterase 17-like [Fragaria ... 50 3e-07 ref|XP_006851246.1| hypothetical protein AMTR_s00180p00034130 [A... 52 2e-06 >ref|XP_004307746.1| PREDICTED: methylesterase 17-like [Fragaria vesca subsp. vesca] Length = 282 Score = 49.7 bits (117), Expect(2) = 3e-07 Identities = 25/55 (45%), Positives = 39/55 (70%), Gaps = 9/55 (16%) Frame = -3 Query: 138 GPW-WLEL--VLETAGHKLSSLDLRSAGIDPSDA------QDYNKPLYDILTTIP 1 G W W ++ ++E +G+K+S++DL+SAGIDPS+ DYNKPL D L+++P Sbjct: 30 GGWCWYKIRCLMEKSGYKVSTVDLKSAGIDPSNVDSVLSFDDYNKPLLDFLSSLP 84 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 4/27 (14%) Frame = -1 Query: 182 ADESLVLVSPAHFVLVH----GGWSWY 114 A+ SL + HFVLVH GGW WY Sbjct: 9 AEVSLKRTATTHFVLVHGIGGGGWCWY 35 >ref|XP_006851246.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda] gi|548854929|gb|ERN12827.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda] Length = 257 Score = 52.4 bits (124), Expect(2) = 2e-06 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 9/55 (16%) Frame = -3 Query: 138 GPW-WLELV--LETAGHKLSSLDLRSAGIDPSDA------QDYNKPLYDILTTIP 1 G W W ++V L GHK+S++DL AGIDP DA ++YNKPL D+++TIP Sbjct: 19 GAWCWYKIVSLLRNKGHKVSAVDLAGAGIDPRDADSIFSFEEYNKPLIDLISTIP 73 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 10/16 (62%), Positives = 10/16 (62%), Gaps = 4/16 (25%) Frame = -1 Query: 149 HFVLVHGG----WSWY 114 HFVLVHG W WY Sbjct: 9 HFVLVHGACHGAWCWY 24