BLASTX nr result
ID: Achyranthes22_contig00029589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00029589 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY18374.1| Disease resistance-responsive family protein, put... 56 4e-06 >gb|EOY18374.1| Disease resistance-responsive family protein, putative [Theobroma cacao] Length = 235 Score = 56.2 bits (134), Expect = 4e-06 Identities = 43/130 (33%), Positives = 60/130 (46%), Gaps = 15/130 (11%) Frame = +1 Query: 67 PTTFSLVILLFSITRPAYSTRILLDP----FQHPTQPSMSFLVQDILPLPTIINPQQLNP 234 P+ LV L ++ + S R L P H +SFL+QD+L + P Sbjct: 7 PSMILLVFFLLTMVNRSTSARTLGKPTSSHHHHRKHHRISFLMQDVL---NVTQPATAKV 63 Query: 235 FKLIPFSKPLRIFPQPYKTIPLTNPNSNFP-----------TNFGIAFPFPSARSLQQEL 381 +PFSKPL FP P IP+ N P ++ G+ FP AR+ QEL Sbjct: 64 TSQLPFSKPLGFFP-PNAGIPIPETNPPVPGTGLSTQTLDISDIGLYFP---ARATLQEL 119 Query: 382 EFGSITTIEE 411 EFG++ TI+E Sbjct: 120 EFGAVMTIDE 129