BLASTX nr result
ID: Achyranthes22_contig00028562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00028562 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63182.1| hypothetical protein M569_11603, partial [Genlise... 55 1e-05 >gb|EPS63182.1| hypothetical protein M569_11603, partial [Genlisea aurea] Length = 344 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 TSQTLKNVKSLMAALCFHQFFEGVGLGGCIVQVSY 105 TSQ L+ +K+LMAAL FHQFFEG+GLGGCI Q + Sbjct: 212 TSQKLETIKTLMAALSFHQFFEGMGLGGCISQAKF 246