BLASTX nr result
ID: Achyranthes22_contig00028115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00028115 (498 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450187.1| hypothetical protein SORBIDRAFT_05g001660 [S... 60 2e-07 ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trich... 56 4e-06 ref|XP_003623515.1| NBS resistance protein [Medicago truncatula]... 56 6e-06 ref|XP_002335051.1| predicted protein [Populus trichocarpa] 55 7e-06 >ref|XP_002450187.1| hypothetical protein SORBIDRAFT_05g001660 [Sorghum bicolor] gi|241936030|gb|EES09175.1| hypothetical protein SORBIDRAFT_05g001660 [Sorghum bicolor] Length = 1279 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +2 Query: 2 IKDLTSLKYLRILFCPDLEKRCKEPNGEDFPKIQHIPDLRIVS 130 IKDLTSL L ILFCPDLE+RCK GED+ I HIPD+ I S Sbjct: 1233 IKDLTSLNLLAILFCPDLERRCKRGTGEDWHLISHIPDIFIGS 1275 >ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|566210834|ref|XP_006372493.1| hypothetical protein POPTR_0017s02170g [Populus trichocarpa] gi|550319119|gb|ERP50290.1| hypothetical protein POPTR_0017s02170g [Populus trichocarpa] Length = 1075 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 2 IKDLTSLKYLRILFCPDLEKRCKEPNGEDFPKIQHIPDLRI 124 I+ LTSL+YL I CP+L+KRC++ GED+PKI HIP++RI Sbjct: 1034 IQHLTSLQYLSIWGCPNLKKRCEKDLGEDWPKIAHIPNIRI 1074 >ref|XP_003623515.1| NBS resistance protein [Medicago truncatula] gi|355498530|gb|AES79733.1| NBS resistance protein [Medicago truncatula] Length = 1007 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 2 IKDLTSLKYLRILFCPDLEKRCKEPNGEDFPKIQHIPDLRI 124 I+ LTSL++LRI CP LE+RCKE GED+ KI HIP ++I Sbjct: 966 IRHLTSLEFLRIWSCPTLEERCKEGTGEDWDKIAHIPKIKI 1006 >ref|XP_002335051.1| predicted protein [Populus trichocarpa] Length = 153 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 2 IKDLTSLKYLRILFCPDLEKRCKEPNGEDFPKIQHIPDLRIVSN 133 I+ LTSL+ L I CP+L+KRC++ GED+PKI HIPD+RI N Sbjct: 110 IQHLTSLRSLTIWDCPNLKKRCEKDLGEDWPKIAHIPDIRINYN 153