BLASTX nr result
ID: Achyranthes22_contig00027292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00027292 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006388709.1| hypothetical protein POPTR_0115s002602g, par... 56 6e-06 ref|XP_002334156.1| cc-nbs-lrr resistance protein [Populus trich... 56 6e-06 ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trich... 55 7e-06 >ref|XP_006388709.1| hypothetical protein POPTR_0115s002602g, partial [Populus trichocarpa] gi|550310691|gb|ERP47623.1| hypothetical protein POPTR_0115s002602g, partial [Populus trichocarpa] Length = 468 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 1 EAIKDLTSLEELIIYRCPDLRERCKGPYGEDFPKIQHIPKLQIRF 135 E+I+ LTSL+ LII CP+L++RC+ GED+PKI HIP + I F Sbjct: 420 ESIQHLTSLQSLIIRGCPNLKKRCEKDLGEDWPKIAHIPHISIDF 464 >ref|XP_002334156.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 826 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 1 EAIKDLTSLEELIIYRCPDLRERCKGPYGEDFPKIQHIPKLQIRF 135 E+I+ LTSL+ LII CP+L++RC+ GED+PKI HIP + I F Sbjct: 778 ESIQHLTSLQSLIIRGCPNLKKRCEKDLGEDWPKIAHIPHISIDF 822 >ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|566210834|ref|XP_006372493.1| hypothetical protein POPTR_0017s02170g [Populus trichocarpa] gi|550319119|gb|ERP50290.1| hypothetical protein POPTR_0017s02170g [Populus trichocarpa] Length = 1075 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = +1 Query: 1 EAIKDLTSLEELIIYRCPDLRERCKGPYGEDFPKIQHIPKLQIR 132 E+I+ LTSL+ L I+ CP+L++RC+ GED+PKI HIP ++IR Sbjct: 1032 ESIQHLTSLQYLSIWGCPNLKKRCEKDLGEDWPKIAHIPNIRIR 1075