BLASTX nr result
ID: Achyranthes22_contig00027141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00027141 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB73912.1| polyprotein [Citrus sinensis] 55 1e-05 gb|AFB73911.1| polyprotein [Citrus sinensis] 55 1e-05 >gb|AFB73912.1| polyprotein [Citrus sinensis] Length = 1309 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 10/45 (22%) Frame = -3 Query: 120 MTRKYEIEKFNGNNFSLWKMNIK----------AIEERPKELTDD 16 M KYEIEKFNGNNFSLWKM +K AI ERP E+TDD Sbjct: 1 MAAKYEIEKFNGNNFSLWKMKMKAVLRKNNCLAAIGERPMEITDD 45 >gb|AFB73911.1| polyprotein [Citrus sinensis] Length = 1309 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 10/45 (22%) Frame = -3 Query: 120 MTRKYEIEKFNGNNFSLWKMNIK----------AIEERPKELTDD 16 M KYEIEKFNGNNFSLWKM +K AI ERP E+TDD Sbjct: 1 MAAKYEIEKFNGNNFSLWKMKMKAVLRKNNCLAAIGERPMEITDD 45