BLASTX nr result
ID: Achyranthes22_contig00027071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00027071 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ24016.1| hypothetical protein PRUPE_ppa005067mg [Prunus pe... 63 5e-08 gb|ESW12238.1| hypothetical protein PHAVU_008G0960001g, partial ... 61 1e-07 gb|EXB66887.1| Ferrochelatase-2 [Morus notabilis] 60 4e-07 ref|XP_003522235.1| PREDICTED: ferrochelatase-2, chloroplastic [... 60 4e-07 ref|XP_003603137.1| Ferrochelatase [Medicago truncatula] gi|3554... 59 7e-07 ref|XP_003603136.1| Ferrochelatase [Medicago truncatula] gi|3554... 59 7e-07 ref|XP_003603135.1| Ferrochelatase [Medicago truncatula] gi|3554... 59 7e-07 ref|XP_006355325.1| PREDICTED: ferrochelatase-2, chloroplastic-l... 58 2e-06 ref|XP_002516467.1| ferrochelatase, putative [Ricinus communis] ... 58 2e-06 gb|AEB38782.1| ferrochelatase isoform I [Nicotiana tabacum] 57 2e-06 ref|XP_004291025.1| PREDICTED: ferrochelatase-2, chloroplastic-l... 57 3e-06 ref|XP_006475957.1| PREDICTED: ferrochelatase-2, chloroplastic-l... 56 6e-06 gb|ESW10538.1| hypothetical protein PHAVU_009G218100g, partial [... 56 6e-06 ref|XP_006450806.1| hypothetical protein CICLE_v10008171mg [Citr... 56 6e-06 ref|XP_006450805.1| hypothetical protein CICLE_v10008171mg [Citr... 56 6e-06 ref|XP_006450804.1| hypothetical protein CICLE_v10008171mg [Citr... 56 6e-06 ref|XP_004249490.1| PREDICTED: ferrochelatase-2, chloroplastic-l... 56 6e-06 ref|XP_003525984.1| PREDICTED: ferrochelatase-2, chloroplastic-l... 56 6e-06 >gb|EMJ24016.1| hypothetical protein PRUPE_ppa005067mg [Prunus persica] Length = 478 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 EVD+DP +Y IKLFFGS LAF+L FSPK+I+AFRN+L+ Sbjct: 441 EVDHDPARYAIKLFFGSFLAFILFFSPKMIMAFRNHLI 478 >gb|ESW12238.1| hypothetical protein PHAVU_008G0960001g, partial [Phaseolus vulgaris] Length = 189 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 +VD+DPVKY IKLFFGS LAF+L SPK+I+AFRN+++ Sbjct: 152 DVDHDPVKYFIKLFFGSFLAFILFLSPKMIMAFRNHVI 189 >gb|EXB66887.1| Ferrochelatase-2 [Morus notabilis] Length = 490 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 322 VDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 VD+DPV+ IKLFFGS+LAF+LLFSP++I AFRNYL Sbjct: 454 VDHDPVRDFIKLFFGSILAFLLLFSPRMISAFRNYL 489 >ref|XP_003522235.1| PREDICTED: ferrochelatase-2, chloroplastic [Glycine max] Length = 481 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 +VD+DPV+Y IK+FFGS+LAF+L SPK+I AFRN+++ Sbjct: 444 DVDHDPVRYFIKMFFGSILAFILFLSPKMITAFRNHVI 481 >ref|XP_003603137.1| Ferrochelatase [Medicago truncatula] gi|355492185|gb|AES73388.1| Ferrochelatase [Medicago truncatula] Length = 280 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 ++D DPVKY K+FFGS+LAF+L FSPK+I AFRN+++ Sbjct: 243 DMDKDPVKYFAKMFFGSILAFLLFFSPKMITAFRNHVI 280 >ref|XP_003603136.1| Ferrochelatase [Medicago truncatula] gi|355492184|gb|AES73387.1| Ferrochelatase [Medicago truncatula] Length = 524 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 ++D DPVKY K+FFGS+LAF+L FSPK+I AFRN+++ Sbjct: 487 DMDKDPVKYFAKMFFGSILAFLLFFSPKMITAFRNHVI 524 >ref|XP_003603135.1| Ferrochelatase [Medicago truncatula] gi|355492183|gb|AES73386.1| Ferrochelatase [Medicago truncatula] Length = 471 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 ++D DPVKY K+FFGS+LAF+L FSPK+I AFRN+++ Sbjct: 434 DMDKDPVKYFAKMFFGSILAFLLFFSPKMITAFRNHVI 471 >ref|XP_006355325.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Solanum tuberosum] Length = 489 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 EVDNDP++Y +K+FFGS+LAFV LFSPK++ AF+ +L Sbjct: 452 EVDNDPMQYFLKMFFGSLLAFVFLFSPKMVSAFKKNIL 489 >ref|XP_002516467.1| ferrochelatase, putative [Ricinus communis] gi|223544287|gb|EEF45808.1| ferrochelatase, putative [Ricinus communis] Length = 480 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 E D DP +Y IKLFFGS+LAF+LL SPK+I AFRN +L Sbjct: 443 EADYDPFRYAIKLFFGSILAFILLLSPKMIFAFRNNVL 480 >gb|AEB38782.1| ferrochelatase isoform I [Nicotiana tabacum] Length = 487 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 EVDNDP++Y IK+ FGS+LAFV LFSPK++ AFR +L Sbjct: 450 EVDNDPMQYFIKMLFGSLLAFVFLFSPKMVSAFRKNIL 487 >ref|XP_004291025.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 485 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/37 (62%), Positives = 34/37 (91%) Frame = -3 Query: 322 VDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 VD+DP++++IK+FFGS LAF+L FSPK+++AFRN L+ Sbjct: 449 VDHDPMRWVIKMFFGSFLAFILFFSPKMLMAFRNNLI 485 >ref|XP_006475957.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Citrus sinensis] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 E D++PV+Y IK+FFGS+LAFVL FSP++I AFRN L Sbjct: 438 EDDHNPVRYAIKMFFGSILAFVLFFSPRMINAFRNQL 474 >gb|ESW10538.1| hypothetical protein PHAVU_009G218100g, partial [Phaseolus vulgaris] Length = 427 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -3 Query: 319 DNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 D+DP+KY IK FFGS LAF+ FSPK+I+AF+N+++ Sbjct: 392 DHDPLKYFIKFFFGSFLAFIFFFSPKMIMAFKNHVI 427 >ref|XP_006450806.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] gi|557554032|gb|ESR64046.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] Length = 459 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 E D++PV+Y IK+FFGS+LAFVL FSP++I AFRN L Sbjct: 422 EDDHNPVRYAIKMFFGSILAFVLFFSPRMINAFRNQL 458 >ref|XP_006450805.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] gi|557554031|gb|ESR64045.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 E D++PV+Y IK+FFGS+LAFVL FSP++I AFRN L Sbjct: 438 EDDHNPVRYAIKMFFGSILAFVLFFSPRMINAFRNQL 474 >ref|XP_006450804.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] gi|557554030|gb|ESR64044.1| hypothetical protein CICLE_v10008171mg [Citrus clementina] Length = 441 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 E D++PV+Y IK+FFGS+LAFVL FSP++I AFRN L Sbjct: 404 EDDHNPVRYAIKMFFGSILAFVLFFSPRMINAFRNQL 440 >ref|XP_004249490.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Solanum lycopersicum] Length = 488 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYL 215 EVDNDP++Y +K+ FG++LAFV LFSPK++ AF+N L Sbjct: 452 EVDNDPMQYFMKMLFGALLAFVFLFSPKMVSAFKNIL 488 >ref|XP_003525984.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Glycine max] Length = 482 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 325 EVDNDPVKYLIKLFFGSVLAFVLLFSPKLILAFRNYLL 212 +VD+DPV Y IK+F GS+LAF+L SPK+I+AFRN ++ Sbjct: 445 DVDHDPVSYFIKIFCGSILAFILFLSPKMIMAFRNQVI 482