BLASTX nr result
ID: Achyranthes22_contig00026810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00026810 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532467.1| Protein kinase APK1B, chloroplast precursor,... 58 1e-06 >ref|XP_002532467.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223527825|gb|EEF29923.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 437 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +2 Query: 62 IDNDEFCDNYNELKFKSLLMKIIWDFGSGCFVPSKHNKEEESVKNGGKIKNP--EHNK 229 I D +CD +NELK K+LL K++W G CF+PS NK S KN KIKN EHNK Sbjct: 26 ISTDHYCD-HNELKLKTLLAKMVWQLGFACFLPSDSNK---SNKNNNKIKNANLEHNK 79