BLASTX nr result
ID: Achyranthes22_contig00026664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00026664 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383408.1| NADP adrenodoxin-like ferredoxin reductase f... 103 2e-20 ref|XP_003525277.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 103 2e-20 ref|XP_006451211.1| hypothetical protein CICLE_v10008139mg [Citr... 103 3e-20 ref|XP_002280736.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 102 4e-20 gb|ESW32313.1| hypothetical protein PHAVU_002G311600g [Phaseolus... 102 7e-20 ref|XP_004299994.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 102 7e-20 ref|XP_006358498.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 101 9e-20 gb|EMJ03218.1| hypothetical protein PRUPE_ppa004960mg [Prunus pe... 101 9e-20 ref|XP_004230380.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 101 9e-20 ref|XP_002527825.1| NADPH:adrenodoxin oxidoreductase, mitochondr... 101 9e-20 ref|XP_006596558.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 100 3e-19 ref|XP_001781394.1| predicted protein [Physcomitrella patens] gi... 100 3e-19 emb|CAA16955.1| ferredoxin--NADP+ reductase - like protein [Arab... 99 6e-19 ref|NP_194962.2| pyridine nucleotide-disulfide oxidoreductase fa... 99 6e-19 ref|XP_006647158.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 99 8e-19 gb|EPS70586.1| hypothetical protein M569_04174, partial [Genlise... 98 1e-18 ref|XP_004503452.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 98 1e-18 ref|XP_006283639.1| hypothetical protein CARUB_v10004697mg [Caps... 98 1e-18 ref|XP_003568742.1| PREDICTED: NADPH:adrenodoxin oxidoreductase,... 98 1e-18 dbj|BAJ90276.1| predicted protein [Hordeum vulgare subsp. vulgar... 98 1e-18 >ref|XP_006383408.1| NADP adrenodoxin-like ferredoxin reductase family protein [Populus trichocarpa] gi|550339018|gb|ERP61205.1| NADP adrenodoxin-like ferredoxin reductase family protein [Populus trichocarpa] Length = 496 Score = 103 bits (258), Expect = 2e-20 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVG+GPAGFYTAEK+LKA++ AEVDI+DRLPTPFGLVRSGVAPDHPDTK Sbjct: 30 NPLRVCVVGTGPAGFYTAEKMLKAHQGAEVDIIDRLPTPFGLVRSGVAPDHPDTK 84 >ref|XP_003525277.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X1 [Glycine max] Length = 484 Score = 103 bits (257), Expect = 2e-20 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVGSGPAGFYTAEK+LKA+++A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 20 NPLRVCVVGSGPAGFYTAEKMLKAHQQAQVDIIDRLPTPFGLVRSGVAPDHPETK 74 >ref|XP_006451211.1| hypothetical protein CICLE_v10008139mg [Citrus clementina] gi|568843544|ref|XP_006475664.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Citrus sinensis] gi|557554437|gb|ESR64451.1| hypothetical protein CICLE_v10008139mg [Citrus clementina] Length = 483 Score = 103 bits (256), Expect = 3e-20 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVGSGPAGFYTAEK LKA+++A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 18 NPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETK 72 >ref|XP_002280736.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial [Vitis vinifera] gi|297738792|emb|CBI28037.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 102 bits (255), Expect = 4e-20 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVGSGPAGFYTAEK+LKA++ AE+DI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 20 NPLRVCVVGSGPAGFYTAEKMLKAHQGAEIDIVDRLPTPFGLVRSGVAPDHPETK 74 >gb|ESW32313.1| hypothetical protein PHAVU_002G311600g [Phaseolus vulgaris] Length = 488 Score = 102 bits (253), Expect = 7e-20 Identities = 46/55 (83%), Positives = 54/55 (98%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVGSGPAGFY+AEK+LKA+++A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 23 NPLRVCVVGSGPAGFYSAEKMLKAHQQAQVDIIDRLPTPFGLVRSGVAPDHPETK 77 >ref|XP_004299994.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 483 Score = 102 bits (253), Expect = 7e-20 Identities = 46/53 (86%), Positives = 53/53 (100%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVC+VGSGPAGFYTAEK+LKA+++A+VDILDRLPTPFGLVRSGVAPDHP+TK Sbjct: 22 LRVCIVGSGPAGFYTAEKMLKAHQEAQVDILDRLPTPFGLVRSGVAPDHPETK 74 >ref|XP_006358498.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565385195|ref|XP_006358499.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565385197|ref|XP_006358500.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X3 [Solanum tuberosum] gi|565385199|ref|XP_006358501.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X4 [Solanum tuberosum] gi|565385201|ref|XP_006358502.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X5 [Solanum tuberosum] gi|565385203|ref|XP_006358503.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X6 [Solanum tuberosum] Length = 485 Score = 101 bits (252), Expect = 9e-20 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVC+VGSGPAGFYTA+K+LKA+E AEVDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 21 LRVCIVGSGPAGFYTADKILKAHEGAEVDIVDRLPTPFGLVRSGVAPDHPETK 73 >gb|EMJ03218.1| hypothetical protein PRUPE_ppa004960mg [Prunus persica] Length = 483 Score = 101 bits (252), Expect = 9e-20 Identities = 46/53 (86%), Positives = 53/53 (100%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVCVVGSGPAGFYTAEK+LKA+++A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 22 LRVCVVGSGPAGFYTAEKMLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETK 74 >ref|XP_004230380.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Solanum lycopersicum] Length = 485 Score = 101 bits (252), Expect = 9e-20 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVC+VGSGPAGFYTA+K+LKA+E AEVDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 21 LRVCIVGSGPAGFYTADKILKAHEGAEVDIVDRLPTPFGLVRSGVAPDHPETK 73 >ref|XP_002527825.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] gi|223532749|gb|EEF34528.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] Length = 492 Score = 101 bits (252), Expect = 9e-20 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVCVVGSGPAGFYTAEK+LKA+ +AE+DI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 28 LRVCVVGSGPAGFYTAEKMLKAHREAEIDIIDRLPTPFGLVRSGVAPDHPETK 80 >ref|XP_006596558.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X1 [Glycine max] gi|571512287|ref|XP_006596559.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X2 [Glycine max] gi|571512291|ref|XP_006596560.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like isoform X3 [Glycine max] Length = 484 Score = 99.8 bits (247), Expect = 3e-19 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = +1 Query: 130 NALRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 N LRVCVVGSGPAGFYTAEK+LKA+++A VDI+DRL TPFGLVRSGVAPDHP+TK Sbjct: 20 NPLRVCVVGSGPAGFYTAEKMLKAHQQAHVDIIDRLSTPFGLVRSGVAPDHPETK 74 >ref|XP_001781394.1| predicted protein [Physcomitrella patens] gi|162667131|gb|EDQ53768.1| predicted protein [Physcomitrella patens] Length = 529 Score = 99.8 bits (247), Expect = 3e-19 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 L+VCVVGSGPAGFYTAEKVLK E+A+VDILDRLPTPFGLVRSGVAPDHP+TK Sbjct: 60 LQVCVVGSGPAGFYTAEKVLKRFERAKVDILDRLPTPFGLVRSGVAPDHPETK 112 >emb|CAA16955.1| ferredoxin--NADP+ reductase - like protein [Arabidopsis thaliana] gi|4049338|emb|CAA22563.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana] gi|7270140|emb|CAB79953.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana] Length = 444 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTKNNCNR 309 L VC+VGSGPAGFYTA+KVLKA+E A VDI+DRLPTPFGLVRSGVAPDHP+TK N+ Sbjct: 22 LHVCIVGSGPAGFYTADKVLKAHEGAHVDIIDRLPTPFGLVRSGVAPDHPETKIAINQ 79 >ref|NP_194962.2| pyridine nucleotide-disulfide oxidoreductase family protein [Arabidopsis thaliana] gi|17481351|dbj|BAB79228.1| MFDR [Arabidopsis thaliana] gi|28192433|gb|AAL82814.1| NADP adrenodoxin-like ferredoxin reductase [Arabidopsis thaliana] gi|332660646|gb|AEE86046.1| pyridine nucleotide-disulfide oxidoreductase family protein [Arabidopsis thaliana] Length = 483 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTKNNCNR 309 L VC+VGSGPAGFYTA+KVLKA+E A VDI+DRLPTPFGLVRSGVAPDHP+TK N+ Sbjct: 22 LHVCIVGSGPAGFYTADKVLKAHEGAHVDIIDRLPTPFGLVRSGVAPDHPETKIAINQ 79 >ref|XP_006647158.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Oryza brachyantha] Length = 496 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 L VCVVGSGPAGFYTA+K+LK +E+A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 34 LHVCVVGSGPAGFYTADKMLKGHERAQVDIIDRLPTPFGLVRSGVAPDHPETK 86 >gb|EPS70586.1| hypothetical protein M569_04174, partial [Genlisea aurea] Length = 334 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVC+VGSGPAGFY AEK+LKA+E EVD++DRLP+PFGLVRSGVAPDHP+TK Sbjct: 10 LRVCIVGSGPAGFYAAEKILKAHETVEVDVIDRLPSPFGLVRSGVAPDHPETK 62 >ref|XP_004503452.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Cicer arietinum] Length = 494 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 LRVCVVGSGPAG YTAEK+LKA ++A+VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 26 LRVCVVGSGPAGCYTAEKMLKARQEAQVDIIDRLPTPFGLVRSGVAPDHPETK 78 >ref|XP_006283639.1| hypothetical protein CARUB_v10004697mg [Capsella rubella] gi|482552344|gb|EOA16537.1| hypothetical protein CARUB_v10004697mg [Capsella rubella] Length = 484 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTKNNCNR 309 L VCVVGSGPAGFYTA+K+LKA+E A VDI+DRLPTPFGLVRSGVAPDHP+TK N+ Sbjct: 22 LHVCVVGSGPAGFYTADKLLKAHEGARVDIIDRLPTPFGLVRSGVAPDHPETKIAINQ 79 >ref|XP_003568742.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Brachypodium distachyon] Length = 497 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 L VCVVGSGPAGFYTAEK+LKA+E +VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 33 LHVCVVGSGPAGFYTAEKMLKAHEGVQVDIIDRLPTPFGLVRSGVAPDHPETK 85 >dbj|BAJ90276.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326514520|dbj|BAJ96247.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 497 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 136 LRVCVVGSGPAGFYTAEKVLKANEKAEVDILDRLPTPFGLVRSGVAPDHPDTK 294 L VCVVGSGPAGFYTAEK+LK +E+ +VDI+DRLPTPFGLVRSGVAPDHP+TK Sbjct: 33 LHVCVVGSGPAGFYTAEKMLKGHERVQVDIIDRLPTPFGLVRSGVAPDHPETK 85