BLASTX nr result
ID: Achyranthes22_contig00026616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00026616 (246 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238506.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 57 3e-06 >ref|XP_004238506.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760-like [Solanum lycopersicum] Length = 331 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 8/84 (9%) Frame = +3 Query: 12 INWKLLKLLSISRAKTDEELISRVLNGCPVLETLELKEWRGFDKLKINSRSLRVLRV--- 182 I+WK LK L ++ K +++I ++L+GCP LE LE+ E+ G L+INS +L+ L+ Sbjct: 173 IDWKFLKTLKLNDLKLQDDIIVKILSGCPALENLEISEFYGLSHLEINSSNLKRLKFEDY 232 Query: 183 -----IKELPPTNLVVPSDCMLEI 239 + P ++V P+ LEI Sbjct: 233 SSYYDESDHPSLDIVAPNIQHLEI 256