BLASTX nr result
ID: Achyranthes22_contig00026594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00026594 (203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267018.1| PREDICTED: immediate early response 3-intera... 55 7e-06 >ref|XP_002267018.1| PREDICTED: immediate early response 3-interacting protein 1 [Vitis vinifera] gi|296090336|emb|CBI40155.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AILNEDRFLAPRGLSF-EATAGRRKSLKQRAVELIYFAQYMR 123 AILNEDRFL+PRG SF E + GRRKSLK + V LIY QYMR Sbjct: 18 AILNEDRFLSPRGWSFDEFSGGRRKSLKGQLVGLIYAVQYMR 59