BLASTX nr result
ID: Achyranthes22_contig00024105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00024105 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491826.1| PREDICTED: F-box protein At2g02240-like [Cit... 60 4e-07 ref|XP_006428543.1| hypothetical protein CICLE_v100122621mg, par... 60 4e-07 >ref|XP_006491826.1| PREDICTED: F-box protein At2g02240-like [Citrus sinensis] Length = 314 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 224 LSLEDEDGEVELSVMEVKAGKWKGGLVIEGIEIRP 120 L+ EDEDGE+E+SV+EV AG WKGGL+I+GIEIRP Sbjct: 255 LNKEDEDGELEMSVLEVAAGDWKGGLIIQGIEIRP 289 >ref|XP_006428543.1| hypothetical protein CICLE_v100122621mg, partial [Citrus clementina] gi|557530600|gb|ESR41783.1| hypothetical protein CICLE_v100122621mg, partial [Citrus clementina] Length = 233 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 224 LSLEDEDGEVELSVMEVKAGKWKGGLVIEGIEIRP 120 L+ EDEDGE+E+SV+EV AG WKGGL+I+GIEIRP Sbjct: 195 LNKEDEDGELEMSVLEVAAGDWKGGLIIQGIEIRP 229