BLASTX nr result
ID: Achyranthes22_contig00023509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00023509 (526 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326194.1| predicted protein [Populus trichocarpa] gi|1... 79 6e-13 gb|ESW34762.1| hypothetical protein PHAVU_001G178800g [Phaseolus... 78 1e-12 gb|EMJ09464.1| hypothetical protein PRUPE_ppa015891mg, partial [... 78 1e-12 gb|AFK42543.1| unknown [Medicago truncatula] 78 1e-12 gb|EXC16167.1| hypothetical protein L484_024335 [Morus notabilis] 76 5e-12 ref|XP_004493991.1| PREDICTED: membrane magnesium transporter-li... 76 5e-12 ref|XP_002519507.1| conserved hypothetical protein [Ricinus comm... 76 5e-12 ref|NP_001235816.1| uncharacterized protein LOC100305468 [Glycin... 75 1e-11 gb|EOY07892.1| Uncharacterized protein TCM_022209 [Theobroma cacao] 73 3e-11 ref|XP_004304455.1| PREDICTED: membrane magnesium transporter-li... 73 4e-11 ref|XP_006428394.1| hypothetical protein CICLE_v10013173mg [Citr... 72 6e-11 ref|XP_003535160.1| PREDICTED: membrane magnesium transporter-li... 72 8e-11 ref|XP_002322888.1| hypothetical protein POPTR_0016s09310g [Popu... 71 2e-10 ref|XP_002282209.1| PREDICTED: uncharacterized protein LOC100260... 70 2e-10 ref|XP_002871028.1| hypothetical protein ARALYDRAFT_487108 [Arab... 70 3e-10 gb|AAM64270.1| unknown [Arabidopsis thaliana] 70 3e-10 ref|XP_006398780.1| hypothetical protein EUTSA_v10015093mg [Eutr... 70 4e-10 ref|XP_004246635.1| PREDICTED: membrane magnesium transporter-li... 70 4e-10 ref|NP_001238413.1| uncharacterized protein LOC100499690 [Glycin... 70 4e-10 ref|NP_001275365.1| membrane magnesium transporter-like [Solanum... 69 5e-10 >ref|XP_002326194.1| predicted protein [Populus trichocarpa] gi|118485409|gb|ABK94561.1| unknown [Populus trichocarpa] gi|118489191|gb|ABK96402.1| unknown [Populus trichocarpa x Populus deltoides] Length = 108 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PPF+V+VEL++G VLCM+A LTVPGNF SIHP S+ENR+VSLP+NL Sbjct: 39 SGPPFSVVVELIVGLVLCMWAALTVPGNFLSIHPHSDENRMVSLPDNL 86 >gb|ESW34762.1| hypothetical protein PHAVU_001G178800g [Phaseolus vulgaris] Length = 106 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PPFNV++EL +G +LC +A LTVPG FQSIHP SEENRIVSLP NL Sbjct: 37 SGPPFNVVIELFVGLLLCFWAALTVPGKFQSIHPHSEENRIVSLPANL 84 >gb|EMJ09464.1| hypothetical protein PRUPE_ppa015891mg, partial [Prunus persica] Length = 156 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP NV+VELL+G VLCM+A LTVPG F SIHP SEENRIVSLP NL Sbjct: 87 SGPPLNVVVELLLGLVLCMWAALTVPGTFLSIHPHSEENRIVSLPANL 134 >gb|AFK42543.1| unknown [Medicago truncatula] Length = 107 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 TAPPFNV++EL IG +LC +A LTVPG F SIHP S+ENRIVSLP NL Sbjct: 38 TAPPFNVVIELFIGLLLCFWAALTVPGKFLSIHPHSDENRIVSLPANL 85 >gb|EXC16167.1| hypothetical protein L484_024335 [Morus notabilis] Length = 106 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 PP NV+VELL+G VLCM+A LTVPG F SIHP SEENRIVSLP NL Sbjct: 39 PPANVMVELLLGLVLCMWAALTVPGKFLSIHPHSEENRIVSLPANL 84 >ref|XP_004493991.1| PREDICTED: membrane magnesium transporter-like [Cicer arietinum] Length = 106 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 PP NV++EL+IGF+LC +A LTVPG F SIHP SEENRIVSLP NL Sbjct: 39 PPLNVVIELVIGFLLCFWAALTVPGKFLSIHPHSEENRIVSLPANL 84 >ref|XP_002519507.1| conserved hypothetical protein [Ricinus communis] gi|223541370|gb|EEF42921.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 PP NV++ELL+G VLCM+A LT PG F SIHP SEENRIVSLP+N+ Sbjct: 39 PPMNVVIELLLGLVLCMWAALTAPGKFLSIHPHSEENRIVSLPDNM 84 >ref|NP_001235816.1| uncharacterized protein LOC100305468 [Glycine max] gi|571495696|ref|XP_006593331.1| PREDICTED: uncharacterized protein LOC100305468 isoform X1 [Glycine max] gi|255625597|gb|ACU13143.1| unknown [Glycine max] Length = 106 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP NV++E+ +G VLCM+A LTVPG F SIHP SEENRIVSLP NL Sbjct: 37 SGPPLNVVIEVTLGLVLCMWAALTVPGKFLSIHPHSEENRIVSLPSNL 84 >gb|EOY07892.1| Uncharacterized protein TCM_022209 [Theobroma cacao] Length = 106 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP NV++ELL+GFV C++A LTVPG F SIHP SEENRIVSL NL Sbjct: 37 SGPPMNVVLELLLGFVFCIWAALTVPGKFLSIHPDSEENRIVSLSANL 84 >ref|XP_004304455.1| PREDICTED: membrane magnesium transporter-like [Fragaria vesca subsp. vesca] Length = 108 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PPF V+ ELL+G VL ++AGLTVPG F SIHP SEENRIV+LP NL Sbjct: 39 SGPPFTVVAELLVGLVLSLWAGLTVPGTFLSIHPHSEENRIVALPANL 86 >ref|XP_006428394.1| hypothetical protein CICLE_v10013173mg [Citrus clementina] gi|568880176|ref|XP_006493010.1| PREDICTED: membrane magnesium transporter-like [Citrus sinensis] gi|557530451|gb|ESR41634.1| hypothetical protein CICLE_v10013173mg [Citrus clementina] Length = 106 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 PP NV++ELL+G VLCM+A L VPG F SIHP S+ENR+VSLP NL Sbjct: 39 PPMNVVIELLLGLVLCMWAALIVPGKFLSIHPDSDENRMVSLPGNL 84 >ref|XP_003535160.1| PREDICTED: membrane magnesium transporter-like [Glycine max] Length = 106 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP NV++E+ +G V CM+A LTVPG F SIHP SEENRIVSLP N+ Sbjct: 37 SGPPLNVVIEVTLGLVFCMWAALTVPGKFLSIHPHSEENRIVSLPSNV 84 >ref|XP_002322888.1| hypothetical protein POPTR_0016s09310g [Populus trichocarpa] gi|566209479|ref|XP_006373882.1| hypothetical protein POPTR_0016s09310g [Populus trichocarpa] gi|118481429|gb|ABK92657.1| unknown [Populus trichocarpa] gi|222867518|gb|EEF04649.1| hypothetical protein POPTR_0016s09310g [Populus trichocarpa] gi|550321164|gb|ERP51679.1| hypothetical protein POPTR_0016s09310g [Populus trichocarpa] Length = 108 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP NV+VEL++G VLC +A +TVPG F SIHP S++NR+VSLP+NL Sbjct: 39 SGPPLNVVVELIVGLVLCTWAAITVPGIFLSIHPHSDDNRMVSLPDNL 86 >ref|XP_002282209.1| PREDICTED: uncharacterized protein LOC100260191 [Vitis vinifera] gi|297741638|emb|CBI32770.3| unnamed protein product [Vitis vinifera] Length = 106 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP V+ E+L+G LCM+AGLTVPG F SIHP SEENRIVSLP N+ Sbjct: 37 SGPPMTVLAEVLLGLGLCMWAGLTVPGKFLSIHPDSEENRIVSLPLNV 84 >ref|XP_002871028.1| hypothetical protein ARALYDRAFT_487108 [Arabidopsis lyrata subsp. lyrata] gi|297316865|gb|EFH47287.1| hypothetical protein ARALYDRAFT_487108 [Arabidopsis lyrata subsp. lyrata] Length = 104 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPEN 142 PP NVI+EL+IG LCM+A LT PG F SIHP S+ENR VSLP+N Sbjct: 39 PPINVILELIIGLALCMWAALTFPGKFLSIHPDSDENRAVSLPDN 83 >gb|AAM64270.1| unknown [Arabidopsis thaliana] Length = 104 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 8 PPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPEN 142 PP NVI+EL+IG LCM+A LT PG F SIHP S+ENR VSLP+N Sbjct: 39 PPINVILELIIGLALCMWAALTFPGKFLSIHPDSDENRAVSLPDN 83 >ref|XP_006398780.1| hypothetical protein EUTSA_v10015093mg [Eutrema salsugineum] gi|557099870|gb|ESQ40233.1| hypothetical protein EUTSA_v10015093mg [Eutrema salsugineum] Length = 104 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPEN 142 + PP NV++EL++G LCM+A LT PG F SIHP S+ENR VSLP+N Sbjct: 37 SGPPMNVVLELIVGLALCMWAALTFPGKFLSIHPDSDENRAVSLPDN 83 >ref|XP_004246635.1| PREDICTED: membrane magnesium transporter-like [Solanum lycopersicum] Length = 105 Score = 69.7 bits (169), Expect = 4e-10 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP +V++EL++ VLC++A + PGNF+SIHP SEENR+V+LP NL Sbjct: 37 SGPPIDVVIELIVSLVLCLWAAMAAPGNFKSIHPQSEENRVVALPANL 84 >ref|NP_001238413.1| uncharacterized protein LOC100499690 [Glycine max] gi|255625821|gb|ACU13255.1| unknown [Glycine max] Length = 106 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PPF+V++EL +G +LC +A LT PG F SIHP SE+NRIVSLP NL Sbjct: 37 SGPPFDVVIELFLGSLLCFWAALTAPGKFLSIHPHSEDNRIVSLPANL 84 >ref|NP_001275365.1| membrane magnesium transporter-like [Solanum tuberosum] gi|413968480|gb|AFW90577.1| hypothetical protein [Solanum tuberosum] Length = 105 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = +2 Query: 2 TAPPFNVIVELLIGFVLCMYAGLTVPGNFQSIHPSSEENRIVSLPENL 145 + PP +V++EL++ VLC++A + PGNF+SIHP SEENR+V+LP NL Sbjct: 37 SGPPIDVVIELIVSLVLCLWAAMDAPGNFKSIHPQSEENRVVALPANL 84