BLASTX nr result
ID: Achyranthes22_contig00022380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00022380 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_568593.1| mitochondrial import receptor subunit TOM7-1 [A... 67 2e-09 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 66 5e-09 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 65 7e-09 gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus pe... 64 2e-08 gb|AFK43929.1| unknown [Medicago truncatula] gi|388517719|gb|AFK... 64 2e-08 gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus... 64 2e-08 ref|XP_006285359.1| hypothetical protein CARUB_v10006750mg [Caps... 64 2e-08 ref|NP_176604.1| mitochondrial import receptor subunit TOM7-2 [A... 64 2e-08 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 64 3e-08 ref|XP_006405320.1| hypothetical protein EUTSA_v10028124mg [Eutr... 63 4e-08 ref|XP_002886356.1| hypothetical protein ARALYDRAFT_893007 [Arab... 63 5e-08 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 63 5e-08 ref|XP_006391654.1| hypothetical protein EUTSA_v10023788mg [Eutr... 62 6e-08 ref|XP_006303083.1| hypothetical protein CARUB_v10021245mg [Caps... 62 6e-08 ref|XP_004240126.1| PREDICTED: mitochondrial import receptor sub... 62 6e-08 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 62 6e-08 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 62 8e-08 ref|XP_003600208.1| Mitochondrial import receptor subunit TOM7-1... 62 1e-07 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 62 1e-07 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 61 1e-07 >ref|NP_568593.1| mitochondrial import receptor subunit TOM7-1 [Arabidopsis thaliana] gi|26397415|sp|Q9ASY8.1|TOM7A_ARATH RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|13605535|gb|AAK32761.1|AF361593_1 AT5g41690/MBK23_23 [Arabidopsis thaliana] gi|16323286|gb|AAL15398.1| AT5g41690/MBK23_23 [Arabidopsis thaliana] gi|110740409|dbj|BAF02099.1| TOM7 - like protein [Arabidopsis thaliana] gi|332007326|gb|AED94709.1| mitochondrial import receptor subunit TOM7-1 [Arabidopsis thaliana] Length = 75 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 76 DCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 D + VKEWTNWSLKK KVV HYG IPL+I++GMNS+PK Sbjct: 25 DKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPK 65 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 61 EEDEKDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 EE+ K VK+W+NW LKK KV+ HYG IPLII IGMNSEPK Sbjct: 26 EEEGSAAAATKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPK 71 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 85 VYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 + ++VKEWTNW++KK KVV HYG IPLII IGMNS+PK Sbjct: 26 ITQAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPK 63 >gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 85 VYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 V +SVKEW+ W++KK KVV HYG IPLII IGMNSEPK Sbjct: 26 VAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPK 63 >gb|AFK43929.1| unknown [Medicago truncatula] gi|388517719|gb|AFK46921.1| unknown [Medicago truncatula] Length = 70 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 73 KDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 +D V SVKEWT W +KK KV+ HYG IPLII IGMNS+PK Sbjct: 19 EDRSVIDSVKEWTTWGMKKTKVIAHYGFIPLIIIIGMNSDPK 60 >gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 70 EKDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 ++D V +S+KEWT W+++K KV+ HYG IPL+I IGMNS+PK Sbjct: 20 QEDRSVSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPK 62 >ref|XP_006285359.1| hypothetical protein CARUB_v10006750mg [Capsella rubella] gi|482554064|gb|EOA18257.1| hypothetical protein CARUB_v10006750mg [Capsella rubella] Length = 74 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 88 YKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 ++ VKEW+NWSLKK KV HYG IPLII IGMNS+PK Sbjct: 28 FEFVKEWSNWSLKKAKVATHYGFIPLIIIIGMNSDPK 64 >ref|NP_176604.1| mitochondrial import receptor subunit TOM7-2 [Arabidopsis thaliana] gi|88943457|sp|Q3ECI7.1|TOM7B_ARATH RecName: Full=Mitochondrial import receptor subunit TOM7-2; AltName: Full=Translocase of outer membrane 7 kDa subunit 2 gi|332196090|gb|AEE34211.1| mitochondrial import receptor subunit TOM7-2 [Arabidopsis thaliana] Length = 77 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 88 YKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 YK K+WTNWSL+K KV HYG IPLII IGMNS+PK Sbjct: 31 YKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPK 67 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 77 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 61 EEDEKDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 E+D V K VKEW WS KK KV+ HYG IPL+I IGMNSEPK Sbjct: 22 EDDGAVAAVGKFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPK 67 >ref|XP_006405320.1| hypothetical protein EUTSA_v10028124mg [Eutrema salsugineum] gi|557106458|gb|ESQ46773.1| hypothetical protein EUTSA_v10028124mg [Eutrema salsugineum] Length = 71 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 97 VKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 VKEW+NWSLKK KV HYG IPLII IGMNS+PK Sbjct: 28 VKEWSNWSLKKAKVATHYGFIPLIIIIGMNSDPK 61 >ref|XP_002886356.1| hypothetical protein ARALYDRAFT_893007 [Arabidopsis lyrata subsp. lyrata] gi|297332197|gb|EFH62615.1| hypothetical protein ARALYDRAFT_893007 [Arabidopsis lyrata subsp. lyrata] Length = 83 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 88 YKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 YK K WTNWSL+K KV HYG IPLII IGMNS+PK Sbjct: 37 YKVFKAWTNWSLEKAKVATHYGFIPLIIIIGMNSDPK 73 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 97 VKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 VKEWT W++KK KVV HYG IPL+I IGMNSEPK Sbjct: 36 VKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPK 69 >ref|XP_006391654.1| hypothetical protein EUTSA_v10023788mg [Eutrema salsugineum] gi|557088160|gb|ESQ28940.1| hypothetical protein EUTSA_v10023788mg [Eutrema salsugineum] Length = 75 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 88 YKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 ++ K+WTNWSLKK KV HYG IPLII IGMNS+PK Sbjct: 29 FQLFKDWTNWSLKKAKVATHYGFIPLIIIIGMNSDPK 65 >ref|XP_006303083.1| hypothetical protein CARUB_v10021245mg [Capsella rubella] gi|482571793|gb|EOA35981.1| hypothetical protein CARUB_v10021245mg [Capsella rubella] Length = 77 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 97 VKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 +K+WTNWSLKK KV HYG IPLII IGMNS+PK Sbjct: 34 LKDWTNWSLKKAKVATHYGFIPLIIIIGMNSDPK 67 >ref|XP_004240126.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 78 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +1 Query: 85 VYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 VY VK+WT W+ KK KV+ HYG IPL+I +GMNSEPK Sbjct: 31 VYTFVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPK 68 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Vitis vinifera] Length = 73 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 91 KSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 K +K+W+NW+LKK KV+ HYG IP++I IGMNSEPK Sbjct: 28 KCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPK 63 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +1 Query: 61 EEDEKDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 E+D V K VKEW W+ KK KV+ HYG IPL+I IGMNSEPK Sbjct: 17 EDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPK 62 >ref|XP_003600208.1| Mitochondrial import receptor subunit TOM7-1 [Medicago truncatula] gi|355489256|gb|AES70459.1| Mitochondrial import receptor subunit TOM7-1 [Medicago truncatula] Length = 133 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 73 KDCKVYKSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 +D S+KEWT W +KK KV+ HYG IPLII IGMNS+PK Sbjct: 19 EDRSAIDSLKEWTTWGIKKTKVIAHYGFIPLIIIIGMNSDPK 60 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 97 VKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 +KEWT W++KK KVV HYG IPL+I IGMNSEPK Sbjct: 36 MKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPK 69 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 91 KSVKEWTNWSLKKGKVVVHYGLIPLIIYIGMNSEPK 198 ++ KEWT W++KK KVV HYG IPL+I IGMNSEPK Sbjct: 28 QAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPK 63