BLASTX nr result
ID: Achyranthes22_contig00022199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00022199 (837 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ08291.1| hypothetical protein PRUPE_ppa023474mg [Prunus pe... 59 3e-06 >gb|EMJ08291.1| hypothetical protein PRUPE_ppa023474mg [Prunus persica] Length = 834 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +2 Query: 2 KKRKLWTPLEEDTLRKGVKQFGEGNWKTILNNYHHILENRTTGMEEQVPIKNK 160 +K K W+ LEEDTLR GV+++G GNWK ILN+Y I E RT +V +K+K Sbjct: 781 RKAKRWSLLEEDTLRTGVQKYGAGNWKFILNSYREIFEERT-----EVDLKDK 828